Entry information : CfioCIIAC01_MH18
Entry ID 11816
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioCIIAC01_MH18
Name CfioCIIAC01_MH18
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioCIIAC01_MH18
start..stop
S start..stop
CfioCIIAC_PJ7 622 0 1..310 1..310
CgloCIIAC01_Naragc5 412 4e-146 1..310 1..319
GgrCIIAC01 382 1e-134 6..307 7..308
ChigCIIAC05 367 5e-128 34..310 44..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 256156..256579 424 N° 2 256639..256882 244 N° 3 256948..257136 189 N° 4 257194..257269 76
join(256156..256579,256639..256882,256948..257136,257194..257269)


exon

Literature and cross-references CfioCIIAC01_MH18
DNA ref. JGI genome:   scaffold_40 (256156..257269)
Cluster/Prediction ref. JGI gene:   1396479 [Incorrect prediction]
Protein sequence: CfioCIIAC01_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (293)
PWM (Da):   %s   32597.22 (30780.2)  
PI (pH):   %s   6.35 (5.69) Peptide Signal:   %s   cut: 18 range:18-310
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHTSNLLLAGLLALANAAVLHHAEDASYAAVVAKDLGTRGGAKCPAVWKQVNTELNSLFMSGSQCNDLARASIRAIFHDCGSWDTSQGLNGGCDGSLIVGVNPDVELNRNENRGLQKIAGVLKDLATKYNTTVADMIVFAGNAAIFLCPGGPKVKTFIGRADSTTSAKDGGLPDVFAPADVLVALFQKKGLDAEALAALLGAHSTSTQNFVDTTKANASQDSTPGKWDVSYYKETYDFATQGTAAPGVFVFPSDSKISTSSSGDIGKKFQGFIGQQNKWSSSFTNAMEKMALFGNDKNNLADCTDSITRL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI (5'end is partial).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACACTTCAAACCTACTTCTCGCTGGCCTCTTGGCACTCGCCAATGCTGCAGTCCTCCACCACGCTGAAGATGCCTCTTACGCTGCCGTCGTCGCGAAGGACCTTGGCACTCGTGGT
GGAGCCAAGTGTCCAGCGGTCTGGAAGCAAGTCAACACCGAGCTCAACTCTCTCTTCATGAGTGGTTCTCAGTGCAATGATCTCGCTCGCGCATCCATTCGCGCCATCTTCCACGACTGC
GGTTCTTGGGACACCTCCCAAGGACTGAACGGCGGCTGCGACGGCTCTCTGATTGTCGGTGTCAATCCTGATGTCGAGCTCAACAGGAATGAGAACAGGGGATTGCAGAAGATTGCCGGC
GTCCTCAAGGATCTTGCTACCAAGTATAACACCACCGTTGCGGACATGATTGTCTTTGCTGGAA
GTAAGTCACACAATTAAAAATCACGTCCGTATCATTGTTGCTGACAAAGCACGCCT
CAGACGCGGCAATCTTCCTCTGCCCTGGTGGACCCAAGGTCAAGACCTTCATCGGCCGTGCTGACAGCACCACTTCCGCCAAGGATGGTGGCTTGCCTGACGTATTTGCTCCCGCCGACG
TCCTCGTGGCACTCTTCCAGAAGAAGGGCCTCGACGCCGAAGCTCTTGCCGCGCTCCTAGGGGCTCACAGCACCTCGACGCAGAACTTTGTTGATACGACCAAGGCCAACGCATCCCAGG
ACTCAAC
GTAAGTGACCTAATCATATCATGAAATTCAAATTCGTTACACCAATGCTGATCATTCACTACCAGGCCTGGAAAATGGGATGTCAGCTACTACAAGGAGACATACGACTTCGC
GACTCAGGGCACTGCTGCACCGGGCGTCTTTGTGTTCCCATCGGACTCCAAGATCTCCACCTCTTCCTCGGGAGACATCGGAAAGAAGTTCCAGGGCTTCATCGGACAGCAGAATAAGTG
GAGCAGCAGCTTTACCAACGC
GTGAGTTACTCTAGGACGAGTTAATGGTACATACGCTCGATTACTGACGCGGAGTAGCATGGAGAAAATGGCACTGTTTGGCAACGATAAGAACAACCT
GGCCGATTGTACCGACAGTATCACCAGGCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACACTTCAAACCTACTTCTCGCTGGCCTCTTGGCACTCGCCAATGCTGCAGTCCTCCACCACGCTGAAGATGCCTCTTACGCTGCCGTCGTCGCGAAGGACCTTGGCACTCGTGGT
GGAGCCAAGTGTCCAGCGGTCTGGAAGCAAGTCAACACCGAGCTCAACTCTCTCTTCATGAGTGGTTCTCAGTGCAATGATCTCGCTCGCGCATCCATTCGCGCCATCTTCCACGACTGC
GGTTCTTGGGACACCTCCCAAGGACTGAACGGCGGCTGCGACGGCTCTCTGATTGTCGGTGTCAATCCTGATGTCGAGCTCAACAGGAATGAGAACAGGGGATTGCAGAAGATTGCCGGC
GTCCTCAAGGATCTTGCTACCAAGTATAACACCACCGTTGCGGACATGATTGTCTTTGCTGGAA
ACGCGGCAATCTTCCTCTGCCCTGGTGGACCCAAGGTCAAGACCTTCATCGGCCGT
GCTGACAGCACCACTTCCGCCAAGGATGGTGGCTTGCCTGACGTATTTGCTCCCGCCGACGTCCTCGTGGCACTCTTCCAGAAGAAGGGCCTCGACGCCGAAGCTCTTGCCGCGCTCCTA
GGGGCTCACAGCACCTCGACGCAGAACTTTGTTGATACGACCAAGGCCAACGCATCCCAGGACTCAAC
GCCTGGAAAATGGGATGTCAGCTACTACAAGGAGACATACGACTTCGCGACT
CAGGGCACTGCTGCACCGGGCGTCTTTGTGTTCCCATCGGACTCCAAGATCTCCACCTCTTCCTCGGGAGACATCGGAAAGAAGTTCCAGGGCTTCATCGGACAGCAGAATAAGTGGAGC
AGCAGCTTTACCAACGC
CATGGAGAAAATGGCACTGTTTGGCAACGATAAGAACAACCTGGCCGATTGTACCGACAGTATCACCAGGCTCTAA

Retrieve as FASTA