Entry information : CfioCIIAA04_MH18
Entry ID 11818
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioCIIAA04_MH18
Name CfioCIIAA04_MH18
Class Asco Class II type A    [Orthogroup: CIIAA002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioCIIAA04_MH18
start..stop
S start..stop
CfioCIIAA04_PJ7 737 0 1..366 1..366
CgraCIIAA04 536 0 4..360 5..368
ChigCIIAA04 532 0 45..366 99..419
CgloCIIAA05_ST23 433 5e-153 16..359 14..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42192..43184 993 N° 2 43243..43350 108  
join(42192..43184,43243..43350)


exon

Literature and cross-references CfioCIIAA04_MH18
DNA ref. JGI genome:   scaffold_157 (42192..43350)
Cluster/Prediction ref. JGI gene:   1622330
Protein sequence: CfioCIIAA04_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (347)
PWM (Da):   %s   37845.9 (35936.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.01 (4.78) Peptide Signal:   %s   cut: 20 range:20-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGSKALIALTALVAVATAYPGMGRGGVGTSHGDMMAHLASREGAADNQNLGDLLKIPDGSLSDVGKDVKGILTGSGSPTTSDAASGNLPDLGSSDCNADKCCVWQHVAADLMPTFRDDNGCTDPARAAIRLGFHDAAGWSLNTGDLGGADGSIVLAPEEIGRPLNKGLEEIVSQMKTWFDKYKDHGAGMADLIQFAANTATVACPGGPRIKTFVGRKDSSVAAPDGLLPDPKDPADKLIELFGNKTISAPGLAALVGAHTASRQRFFDTSKVNAPQDTTPNVWDVDFYGQTLAGAPAEVVTFPSDAVLSKDPRSAPAFQAFANNAPLWGGAYAKQYLRLSLLGVFNINDLTDCSKALPAGTGVKR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGATCGAAAGCACTCATTGCTCTCACGGCACTCGTAGCCGTTGCCACTGCATACCCCGGCATGGGACGGGGCGGTGTCGGAACGAGCCACGGAGATATGATGGCGCATCTCGCT
AGCCGAGAGGGTGCCGCAGACAACCAAAATCTCGGCGATCTCCTCAAGATCCCCGACGGATCCTTGTCCGACGTCGGCAAGGATGTAAAGGGCATCCTCACGGGCTCCGGATCGCCAACC
ACGTCCGATGCCGCCAGCGGCAACCTCCCTGATCTCGGCAGCTCCGACTGCAACGCGGATAAGTGCTGTGTGTGGCAGCACGTCGCTGCCGACCTGATGCCCACGTTCCGTGACGACAAT
GGCTGCACCGACCCTGCCCGCGCCGCCATCCGCCTCGGATTCCATGACGCTGCTGGGTGGAGCTTGAACACCGGCGACCTCGGCGGTGCCGATGGCTCCATCGTTCTCGCTCCCGAGGAA
ATCGGGCGCCCTCTCAACAAGGGCTTGGAGGAGATCGTATCGCAGATGAAGACGTGGTTCGACAAGTACAAGGATCACGGTGCCGGTATGGCAGACTTGATCCAGTTTGCCGCCAACACC
GCGACGGTGGCATGCCCTGGTGGACCGAGAATCAAGACTTTCGTCGGCCGCAAGGATTCTTCCGTGGCTGCTCCCGATGGTTTGCTTCCGGACCCGAAGGACCCCGCCGACAAGCTGATC
GAGCTGTTTGGCAACAAGACTATCAGTGCCCCTGGTCTTGCCGCCCTTGTCGGTGCGCACACTGCCAGCCGTCAACGCTTCTTCGACACATCCAAGGTCAACGCCCCGCAGGATACCACG
CCCAATGTCTGGGATGTTGACTTTTACGGACAAACTTTGGCTGGAGCTCCTGCCGAGGTTGTTACCTTCCCCAGTGACGCCGTTCTGTCCAAGGATCCCCGTTCGGCTCCGGCATTCCAG
GCCTTCGCTAACAACGCACCGCTTTGGGGCGGA
GTAAGTTTACACTTAATCCCATCTTAGTACTTCAGGAGTATGGCTAACCAAATTACAGGCATATGCCAAGCAGTACCTCCGTTTGAG
TCTCCTTGGTGTCTTCAACATCAATGACTTGACTGATTGCAGCAAGGCGCTCCCCGCCGGTACCGGTGTCAAGAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGATCGAAAGCACTCATTGCTCTCACGGCACTCGTAGCCGTTGCCACTGCATACCCCGGCATGGGACGGGGCGGTGTCGGAACGAGCCACGGAGATATGATGGCGCATCTCGCT
AGCCGAGAGGGTGCCGCAGACAACCAAAATCTCGGCGATCTCCTCAAGATCCCCGACGGATCCTTGTCCGACGTCGGCAAGGATGTAAAGGGCATCCTCACGGGCTCCGGATCGCCAACC
ACGTCCGATGCCGCCAGCGGCAACCTCCCTGATCTCGGCAGCTCCGACTGCAACGCGGATAAGTGCTGTGTGTGGCAGCACGTCGCTGCCGACCTGATGCCCACGTTCCGTGACGACAAT
GGCTGCACCGACCCTGCCCGCGCCGCCATCCGCCTCGGATTCCATGACGCTGCTGGGTGGAGCTTGAACACCGGCGACCTCGGCGGTGCCGATGGCTCCATCGTTCTCGCTCCCGAGGAA
ATCGGGCGCCCTCTCAACAAGGGCTTGGAGGAGATCGTATCGCAGATGAAGACGTGGTTCGACAAGTACAAGGATCACGGTGCCGGTATGGCAGACTTGATCCAGTTTGCCGCCAACACC
GCGACGGTGGCATGCCCTGGTGGACCGAGAATCAAGACTTTCGTCGGCCGCAAGGATTCTTCCGTGGCTGCTCCCGATGGTTTGCTTCCGGACCCGAAGGACCCCGCCGACAAGCTGATC
GAGCTGTTTGGCAACAAGACTATCAGTGCCCCTGGTCTTGCCGCCCTTGTCGGTGCGCACACTGCCAGCCGTCAACGCTTCTTCGACACATCCAAGGTCAACGCCCCGCAGGATACCACG
CCCAATGTCTGGGATGTTGACTTTTACGGACAAACTTTGGCTGGAGCTCCTGCCGAGGTTGTTACCTTCCCCAGTGACGCCGTTCTGTCCAAGGATCCCCGTTCGGCTCCGGCATTCCAG
GCCTTCGCTAACAACGCACCGCTTTGGGGCGGA
GCATATGCCAAGCAGTACCTCCGTTTGAGTCTCCTTGGTGTCTTCAACATCAATGACTTGACTGATTGCAGCAAGGCGCTCCCCGCC
GGTACCGGTGTCAAGAGATAG

Retrieve as FASTA