Entry information : CfioAPx-CcP01_MH18
Entry ID 11821
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioAPx-CcP01_MH18
Name CfioAPx-CcP01_MH18
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioAPx-CcP01_MH18
start..stop
S start..stop
CfioAPx-CcP01_PJ7 1096 0 1..536 1..536
ChigAPx-CcP01 915 0 1..536 1..538
CgloAPx-CcP03_ST23 915 0 1..536 1..539
CorbiAPx-CcP1 914 0 1..536 1..539
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 99274..99409 136 N° 2 97747..99221 1475  
complement(join(97747..99221,99274..99409))


exon

Literature and cross-references CfioAPx-CcP01_MH18
DNA ref. JGI genome:   scaffold_25 (99409..97747)
Cluster/Prediction ref. JGI gene:   1313015
Protein sequence: CfioAPx-CcP01_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   537 (514)
PWM (Da):   %s   57660.28 (55201.0)  
PI (pH):   %s   4.49 (4.48) Peptide Signal:   %s   cut: 23 range:23-536
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRQGILSTLALASIAATEYVWPSQYDELEDHLSLQSGYLRRGFIDGVITCGFGTSIPGRQNSAEWIRAAFHDMATHDAAAGTGGLDASIFFELDRPENIGGAFNNTFGFFSSFHSIRASASDLLAMSVLVASFACGGIQIPFRAGRIDAQEAGPAGVPEPQTDLNTTQQAFTKAGFSQSDMIAMVACGHTLGGVHSMDFPEIVGVAADPNNDTVAHFDTEFAKFDNVVVTEYLDGTTKNPLVVGTNDTLNSDKRIFAADGNKTMQAMADPDAFQATCADIFSRMIDTVPANVKLSDPIVATDIKPYISGLFLKDDGNLSFGGRIRIRTTAVTGRDPNDLSVQLTYADRNGNGSTVITTRKATFQGGSASGLWRESFYWWEFDTVISPDTGISKFYIHVTKPSTNETITYDNAGNGYPMSDVLLYQQSKSCIGNVADGKLPVTVKALVRKDRVPATADGLTMDLVHEVRRQGVIVPRLDVEKINFQATEEDQGQWSVYTASGSVDADGWNTSFDIKLGGEDPTEVAFQKTGALSSCS

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCAGGGCATTCTTTCCACGCTCGCGCTAGCGTCCATCGCCGCGACGGAGTATGTTTGGCCTTCTCAGTACGATGAGCTCGAGGATCATCTCTCTCTCCAGTCCGGATACCTTCGA
AGAGGCTTCATCGATG
GTCAGTTGCATTTCTGCCACGGAACCTTGATCAACTACTGACAAGTCATTAGGCGTTATTACGTGCGGGTTCGGCACAAGCATTCCAGGCCGCCAGAACTCTGC
TGAATGGATCCGCGCCGCTTTCCACGACATGGCTACGCACGATGCTGCCGCTGGCACTGGTGGCTTGGACGCGTCCATCTTCTTCGAGTTGGACCGCCCGGAGAACATCGGAGGCGCCTT
CAACAACACCTTCGGATTTTTCAGCAGCTTCCACTCCATCCGCGCCTCTGCCTCTGATTTGTTGGCCATGAGTGTCCTCGTCGCCAGCTTTGCCTGCGGCGGGATCCAAATCCCGTTCCG
AGCCGGCCGTATTGACGCTCAAGAGGCCGGCCCTGCCGGTGTCCCGGAGCCTCAGACCGATCTCAACACTACCCAGCAGGCTTTCACCAAGGCAGGCTTCTCTCAGAGCGACATGATTGC
CATGGTTGCATGCGGTCATACTCTTGGAGGTGTACACAGCATGGACTTCCCCGAGATCGTCGGCGTCGCGGCGGACCCCAATAACGACACCGTAGCGCACTTCGATACCGAATTTGCAAA
GTTCGACAACGTCGTCGTGACTGAATATCTGGATGGCACAACCAAGAACCCTCTGGTTGTTGGCACAAACGATACCCTCAACTCAGACAAGCGTATCTTCGCTGCAGATGGAAACAAGAC
GATGCAAGCCATGGCCGACCCTGACGCTTTCCAGGCTACCTGCGCCGATATCTTCAGTCGTATGATTGATACTGTCCCCGCCAACGTTAAGCTCAGCGACCCCATCGTAGCCACAGACAT
TAAGCCTTACATCAGCGGGCTCTTCCTCAAGGACGACGGCAACCTGTCCTTCGGCGGCCGCATTCGCATCCGCACCACCGCGGTCACTGGCCGGGATCCTAATGATCTCTCGGTTCAGCT
GACGTACGCTGACCGCAACGGCAACGGATCAACCGTCATTACTACCCGTAAGGCGACCTTCCAAGGTGGTAGCGCCTCTGGCTTATGGAGGGAGAGCTTCTACTGGTGGGAGTTCGACAC
CGTAATCAGCCCTGACACGGGCATCAGCAAGTTCTACATCCACGTTACGAAGCCGTCAACCAACGAGACCATCACGTACGATAACGCTGGCAACGGATATCCCATGAGCGATGTCCTCCT
GTACCAGCAGTCTAAGTCCTGCATTGGAAATGTCGCGGATGGAAAGCTGCCGGTCACAGTCAAGGCTCTTGTTCGCAAGGACCGTGTGCCCGCCACTGCTGATGGCCTGACTATGGATCT
GGTTCACGAGGTCCGCAGGCAGGGGGTGATTGTTCCTAGGCTTGACGTCGAAAAGATCAACTTCCAAGCCACTGAAGAAGATCAAGGCCAGTGGTCGGTCTACACAGCCAGTGGAAGCGT
CGATGCTGATGGATGGAATACCAGCTTTGATATCAAGTTGGGTGGCGAGGACCCCACCGAAGTTGCGTTTCAAAAGACCGGAGCTCTAAGTTCCTGCAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCAGGGCATTCTTTCCACGCTCGCGCTAGCGTCCATCGCCGCGACGGAGTATGTTTGGCCTTCTCAGTACGATGAGCTCGAGGATCATCTCTCTCTCCAGTCCGGATACCTTCGA
AGAGGCTTCATCGATG
GCGTTATTACGTGCGGGTTCGGCACAAGCATTCCAGGCCGCCAGAACTCTGCTGAATGGATCCGCGCCGCTTTCCACGACATGGCTACGCACGATGCTGCCGCT
GGCACTGGTGGCTTGGACGCGTCCATCTTCTTCGAGTTGGACCGCCCGGAGAACATCGGAGGCGCCTTCAACAACACCTTCGGATTTTTCAGCAGCTTCCACTCCATCCGCGCCTCTGCC
TCTGATTTGTTGGCCATGAGTGTCCTCGTCGCCAGCTTTGCCTGCGGCGGGATCCAAATCCCGTTCCGAGCCGGCCGTATTGACGCTCAAGAGGCCGGCCCTGCCGGTGTCCCGGAGCCT
CAGACCGATCTCAACACTACCCAGCAGGCTTTCACCAAGGCAGGCTTCTCTCAGAGCGACATGATTGCCATGGTTGCATGCGGTCATACTCTTGGAGGTGTACACAGCATGGACTTCCCC
GAGATCGTCGGCGTCGCGGCGGACCCCAATAACGACACCGTAGCGCACTTCGATACCGAATTTGCAAAGTTCGACAACGTCGTCGTGACTGAATATCTGGATGGCACAACCAAGAACCCT
CTGGTTGTTGGCACAAACGATACCCTCAACTCAGACAAGCGTATCTTCGCTGCAGATGGAAACAAGACGATGCAAGCCATGGCCGACCCTGACGCTTTCCAGGCTACCTGCGCCGATATC
TTCAGTCGTATGATTGATACTGTCCCCGCCAACGTTAAGCTCAGCGACCCCATCGTAGCCACAGACATTAAGCCTTACATCAGCGGGCTCTTCCTCAAGGACGACGGCAACCTGTCCTTC
GGCGGCCGCATTCGCATCCGCACCACCGCGGTCACTGGCCGGGATCCTAATGATCTCTCGGTTCAGCTGACGTACGCTGACCGCAACGGCAACGGATCAACCGTCATTACTACCCGTAAG
GCGACCTTCCAAGGTGGTAGCGCCTCTGGCTTATGGAGGGAGAGCTTCTACTGGTGGGAGTTCGACACCGTAATCAGCCCTGACACGGGCATCAGCAAGTTCTACATCCACGTTACGAAG
CCGTCAACCAACGAGACCATCACGTACGATAACGCTGGCAACGGATATCCCATGAGCGATGTCCTCCTGTACCAGCAGTCTAAGTCCTGCATTGGAAATGTCGCGGATGGAAAGCTGCCG
GTCACAGTCAAGGCTCTTGTTCGCAAGGACCGTGTGCCCGCCACTGCTGATGGCCTGACTATGGATCTGGTTCACGAGGTCCGCAGGCAGGGGGTGATTGTTCCTAGGCTTGACGTCGAA
AAGATCAACTTCCAAGCCACTGAAGAAGATCAAGGCCAGTGGTCGGTCTACACAGCCAGTGGAAGCGTCGATGCTGATGGATGGAATACCAGCTTTGATATCAAGTTGGGTGGCGAGGAC
CCCACCGAAGTTGCGTTTCAAAAGACCGGAGCTCTAAGTTCCTGCAGCTAG

Retrieve as FASTA