Entry information : CfioGPx01_MH18
Entry ID 11824
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: CfioGPx01_MH18
Name CfioGPx01_MH18
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioGPx01_MH18
start..stop
S start..stop
ChigGPx01 401 3e-144 1..241 1..240
CgraGPx01 391 3e-140 1..241 1..236
CgloGPx01_ST23 338 4e-120 74..241 1..168
VaaGPx01 323 5e-113 36..238 31..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29435..29696 262 N° 2 29784..30244 461  
join(29435..29696,29784..30244)


exon

Literature and cross-references CfioGPx01_MH18
DNA ref. JGI genome:   scaffold_135 (29435..30244)
Cluster/Prediction ref. Genebank:   1574477
Protein sequence: CfioGPx01_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   27097.07  
PI (pH):   %s   9.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFRQLHTRALSPITTSTAASVAVHHQRPFLPYIYTLKTCALSPNRPQLINKIQLRGNLRAIAEKQQQIHTTAAMASATGFYDFKPLDKRGQEVPLADYKGKVVLVVNTASKCGFTPQYAGLEKLYKDVKEKHGDDFVVLGFPCNQFGGQEPGSDDEIQNFCQVNYGVSFPIMQKIDVNGDAANPLFQWLKEEKPGIMGLKRIKWNFEKFLVGRDGQVKGRWASTTKPESLEKPILDELEK

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCGTCAACTACATACCAGAGCCCTTTCTCCCATAACAACTTCCACTGCTGCTTCTGTAGCTGTGCATCATCAAAGACCTTTTCTTCCCTACATCTACACGCTCAAAACTTGTGCA
TTATCGCCGAACCGACCGCAACTAATCAACAAGATCCAATTGCGGGGTAATCTCAGAGCTATCGCAGAAAAGCAACAACAAATCCACACAACCGCAGCAATGGCTTCCGCAACAGGCTTC
TACGACTTCAAGCCCTTGGACA
GTACGTGTGATTCCATTGTTTGCGCGATAACTAACCAATCACTTTGAAAATGCTCTGGCTGACATGCATTTTTCCCCTCCAAAACAGAGCGCGGCCAA
GAGGTCCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCGTCGTCAACACCGCCTCCAAGTGCGGCTTCACCCCGCAGTACGCCGGCCTCGAGAAGCTCTACAAGGACGTCAAGGAGAAG
CACGGCGACGACTTTGTCGTACTCGGCTTCCCCTGTAACCAGTTTGGCGGCCAGGAGCCCGGCTCCGACGACGAGATCCAGAACTTCTGCCAGGTCAACTACGGCGTCTCCTTCCCCATC
ATGCAAAAGATTGACGTCAACGGCGACGCCGCCAACCCCCTCTTCCAGTGGCTCAAGGAGGAGAAGCCCGGCATCATGGGCCTCAAGCGCATCAAGTGGAACTTTGAAAAGTTCCTCGTC
GGCCGCGACGGCCAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGAGCTTGGAGAAGCCCATCCTCGACGAGCTGGAGAAGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCGTCAACTACATACCAGAGCCCTTTCTCCCATAACAACTTCCACTGCTGCTTCTGTAGCTGTGCATCATCAAAGACCTTTTCTTCCCTACATCTACACGCTCAAAACTTGTGCA
TTATCGCCGAACCGACCGCAACTAATCAACAAGATCCAATTGCGGGGTAATCTCAGAGCTATCGCAGAAAAGCAACAACAAATCCACACAACCGCAGCAATGGCTTCCGCAACAGGCTTC
TACGACTTCAAGCCCTTGGACA
AGCGCGGCCAAGAGGTCCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCGTCGTCAACACCGCCTCCAAGTGCGGCTTCACCCCGCAGTACGCCGGC
CTCGAGAAGCTCTACAAGGACGTCAAGGAGAAGCACGGCGACGACTTTGTCGTACTCGGCTTCCCCTGTAACCAGTTTGGCGGCCAGGAGCCCGGCTCCGACGACGAGATCCAGAACTTC
TGCCAGGTCAACTACGGCGTCTCCTTCCCCATCATGCAAAAGATTGACGTCAACGGCGACGCCGCCAACCCCCTCTTCCAGTGGCTCAAGGAGGAGAAGCCCGGCATCATGGGCCTCAAG
CGCATCAAGTGGAACTTTGAAAAGTTCCTCGTCGGCCGCGACGGCCAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGAGCTTGGAGAAGCCCATCCTCGACGAGCTGGAGAAG
AAA

Retrieve as FASTA