Entry information : CcorGPx03
Entry ID 11831
Creation 2013-05-06 (Gisèle Passaia )
Last sequence changes 2016-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: CcorGPx03
Name CcorGPx03
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx03
start..stop
S start..stop
CcorGPx01 216 1e-73 1..159 1..159
CcorGPx02 215 5e-73 1..159 1..159
CcorGPx05 207 9e-70 1..152 1..152
SbayGPx02 191 9e-64 2..159 3..160
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 201..275 75 N° 2 332..543 212 N° 3 595..691 97 N° 4 747..849 103
join(201..275,332..543,595..691,747..849)


exon

Literature and cross-references CcorGPx03
Cluster/Prediction ref. JGI gene:   76242
Protein sequence: CcorGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   18686.69  
PI (pH):   %s   9.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIYDFSVKDRKNKDHDLSQYENKVILIVNIATKCGFTPQLKSLEKLYKKYKDKDFVILGFPCTQFLNQAPGTDDQVHSFCSLKYDVSFPMMKKVEVNGEEALPLYEYIKAEKPGIFGLKRIKWNFKFLIDRQGNIAYRFPSIVDPYFIDPFVGSLIKS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns),
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCAATTTATGATTTTAGTGTAAAAGATCGCAAGAACAAGGATCATGACTTAAGTCAATACGAAAACAAAGTAATTAAAAACTCTAAAATAAAATATATAGAATTAACTTAAGCC
ATTTAATTTAGGTTATATTAATAGTAAACATCGCAACAAAGTGTGGATTTACCCCTCAACTAAAAAGTCTCGAAAAACTCTATAAAAAGTACAAAGATAAAGATTTTGTTATATTAGGAT
TCCCCTGTACTCAATTCTTGAATCAAGCCCCTGGTACAGACGATCAAGTCCACTCATTTTGTTCACTCAAATACGATGTAAGCTTTCCAATGATGAAAAAAGT
GTAAGTATAAAAAATTT
AACGGTTATCAAGTATATTAATTAGAATTTATAGTGAAGTTAACGGAGAAGAAGCCTTACCCTTATACGAATACATTAAAGCTGAAAAGCCTGGTATATTTGGGTTAAAGCGTATTAAAT
GGAATTTTGAG
GTAATTCGCACAATATTTAATATTGAAAATAACTAATAATTATTTATATTTTTAGAAATTTTTAATAGATCGTCAAGGAAACATAGCTTACAGATTCCCTAGTATTGTC
GATCCTTATTTTATTGATCCCTTCGTTGGTAGTTTAATTAAAAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCAATTTATGATTTTAGTGTAAAAGATCGCAAGAACAAGGATCATGACTTAAGTCAATACGAAAACAAAGTTATATTAATAGTAAACATCGCAACAAAGTGTGGATTTACCCCT
CAACTAAAAAGTCTCGAAAAACTCTATAAAAAGTACAAAGATAAAGATTTTGTTATATTAGGATTCCCCTGTACTCAATTCTTGAATCAAGCCCCTGGTACAGACGATCAAGTCCACTCA
TTTTGTTCACTCAAATACGATGTAAGCTTTCCAATGATGAAAAAAGT
TGAAGTTAACGGAGAAGAAGCCTTACCCTTATACGAATACATTAAAGCTGAAAAGCCTGGTATATTTGGGTTA
AAGCGTATTAAATGGAATTTTGAG
AAATTTTTAATAGATCGTCAAGGAAACATAGCTTACAGATTCCCTAGTATTGTCGATCCTTATTTTATTGATCCCTTCGTTGGTAGTTTAATTAAA
AGTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATAGTGTAT TTAAGCAGGC TATAGAAGAA ACTGAATAGA TTATTGAATA AGAAACCAAA ATGGCATCAA TTTATGATTT TAGTGTAAAA GATCGCAAGA ACAAGGATCA TGACTTAAGT  CAATACGAAA ACAAAGTAAT TAAAAACTCT AAAATAAAAT ATATAGAATT AACTTAAGCC ATTTAATTTA GGTTATATTA ATAGTAAACA TCGCAACAAA GTGTGGATTT ACCCCTCAAC  TAAAAAGTCT CGAAAAACTC TATAAAAAGT ACAAAGATAA AGATTTTGTT ATATTAGGAT TCCCCTGTAC TCAATTCTTG AATCAAGCCC CTGGTACAGA CGATCAAGTC CACTCATTTT  GTTCACTCAA ATACGATGTA AGCTTTCCAA TGATGAAAAA AGTGTAAGTA TAAAAAATTT AACGGTTATC AAGTATATTA ATTAGAATTT ATAGTGAAGT TAACGGAGAA GAAGCCTTAC  CCTTATACGA ATACATTAAA GCTGAAAAGC CTGGTATATT TGGGTTAAAG CGTATTAAAT GGAATTTTGA GGTAATTCGC ACAATATTTA ATATTGAAAA TAACTAATAA TTATTTATAT 
TTTTAGAAAT TTTTAATAGA TCGTCAAGGA AACATAGCTT ACAGATTCCC TAGTATTGTC GATCCTTATT TTATTGATCC CTTCGTTGGT AGTTTAATTA AAAGTTAA 

Retrieve as FASTA