Entry information : CcorGPx04
Entry ID 11832
Creation 2013-05-06 (Gisèle Passaia )
Last sequence changes 2016-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: CcorGPx04
Name CcorGPx04
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx04
start..stop
S start..stop
SjapGPx01 133 1e-40 15..174 1..158
BthGPx 132 2e-40 15..174 1..159
CcorGPx06 134 3e-40 3..174 22..194
SYspGPx01 132 3e-40 18..174 9..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 201..468 268 N° 2 519..576 58 N° 3 627..729 103 N° 4 784..879 96
join(201..468,519..576,627..729,784..879)


exon

Literature and cross-references CcorGPx04
Cluster/Prediction ref. JGI gene:   171398
Protein sequence: CcorGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   20428.67  
PI (pH):   %s   7.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSIYLNYFHSENQLERIYNFSLTDIEGNNFKLDKLQNKVILIVNSACECGHASQLGDLQKMYNKFRRKGLEIVLLPSDEFNQELETNREINEFLKTEYKVEFPIMSKISLSGKEANPLITYLISELPHPKDAKNNKIKWNFKFLINRSGKLVKRYASYEKLNEVVKDIEDLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATCCATATATCTCAACTATTTCCACTCAGAAAATCAGCTAGAACGCATTTATAATTTCAGTTTAACTGATATAGAAGGAAATAACTTTAAACTAGATAAACTACAAAATAAAGTT
ATTTTGATAGTAAACTCAGCTTGTGAATGTGGTCATGCTAGTCAACTAGGGGACCTGCAAAAGATGTATAATAAATTTAGAAGAAAAGGTTTAGAAATTGTGCTACTTCCAAGTGACGAA
TTCAATCAAGAGCTGGAAACCAATAGAG
GTAATAAAGTACTGATTATATTATAGCTTGATTAACATATGAAATTTTAGAAATCAATGAATTTTTAAAAACTGAATATAAAGTAGAATTTC
CTATAATGTCAAAAAT
GTAAGAAAAATGCTATAATAGCTCTATAATATTAACAAGTGTATCTATAGCTCTCTATCTGGAAAAGAAGCAAATCCCTTAATCACATATTTAATAAGTGAACT
ACCGCATCCAAAAGACGCTAAAAATAACAAAATTAAATGGAATTTTGAA
GTAAAAACACAAATAATCGTAAAAATTTATCTAATCTTTATTGATTTATAATAGAAATTTTTAATTAATCG
CAGCGGAAAGCTAGTTAAAAGGTACGCATCTTACGAAAAGCTTAATGAAGTAGTTAAGGATATAGAAGATCTATTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATCCATATATCTCAACTATTTCCACTCAGAAAATCAGCTAGAACGCATTTATAATTTCAGTTTAACTGATATAGAAGGAAATAACTTTAAACTAGATAAACTACAAAATAAAGTT
ATTTTGATAGTAAACTCAGCTTGTGAATGTGGTCATGCTAGTCAACTAGGGGACCTGCAAAAGATGTATAATAAATTTAGAAGAAAAGGTTTAGAAATTGTGCTACTTCCAAGTGACGAA
TTCAATCAAGAGCTGGAAACCAATAGAG
AAATCAATGAATTTTTAAAAACTGAATATAAAGTAGAATTTCCTATAATGTCAAAAATCTCTCTATCTGGAAAAGAAGCAAATCCCTTAATC
ACATATTTAATAAGTGAACTACCGCATCCAAAAGACGCTAAAAATAACAAAATTAAATGGAATTTTGAA
AAATTTTTAATTAATCGCAGCGGAAAGCTAGTTAAAAGGTACGCATCTTAC
GAAAAGCTTAATGAAGTAGTTAAGGATATAGAAGATCTATTATAA

Retrieve as FASTA