Entry information : CcorGPx05
Entry ID 11833
Creation 2013-05-06 (Gisèle Passaia )
Last sequence changes 2016-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: CcorGPx05
Name CcorGPx05
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx05
start..stop
S start..stop
CcorGPx02 280 1e-98 1..162 1..162
CcorGPx01 266 3e-93 1..164 1..164
CcasGPx01 223 2e-76 1..159 1..159
CzmGPx 224 5e-76 3..159 43..201
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 214..288 75 N° 2 341..552 212 N° 3 604..700 97 N° 4 758..868 111
join(214..288,341..552,604..700,758..868)


exon

Literature and cross-references CcorGPx05
Cluster/Prediction ref. JGI gene:   78692
Protein sequence: CcorGPx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   165
PWM (Da):   %s   18659.58  
PI (pH):   %s   5.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSFYDFKVKDKVDQDHDLSQYKGKVVLVVNTASKCGFTPQFDGLEKLYQKYKERNVVVLGFPCNQFGGQDPGSQEEIESFCKVNYGVTFPILKKIEVNGDKVEPLYEFLKTEKPGIFGLTRIKWNFKFLIDANGKVISRFSSLATPQSIESEIELLLPAEEN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTCATTTTACGATTTTAAAGTTAAAGATAAAGTTGATCAAGATCACGACTTATCCCAATATAAGGGAAAGGTAAATCATATACTATCATTAAAGCTTCCCATACTGATCCAATAC
TATATAGGTTGTTCTTGTAGTTAACACTGCTTCCAAATGTGGTTTCACCCCTCAGTTTGATGGCTTAGAAAAGTTATACCAAAAGTACAAGGAAAGAAACGTTGTCGTATTAGGTTTCCC
TTGTAATCAATTTGGCGGTCAAGACCCTGGAAGTCAAGAAGAAATTGAAAGTTTCTGTAAAGTCAACTATGGTGTTACTTTCCCTATTTTGAAAAAGAT
GTAAGCTGATGTTTTGCTGTT
CAAGTTGACTATACTTATGATTAATTTTAGTGAAGTTAATGGTGATAAGGTAGAGCCTTTATACGAATTCTTAAAAACAGAGAAGCCAGGTATTTTTGGTTTAACTAGAATTAAATGGAA
TTTTGAG
GTAAATTGAATACTTTACTAGACTATTCCTGTAATTAATAACCTACTTTAATTTTAGAAATTCTTAATCGATGCCAATGGAAAGGTTATTTCAAGATTCTCTAGTCTTGCAAC
CCCTCAAAGTATTGAATCAGAAATTGAACTATTACTCCCTGCTGAAGAAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTCATTTTACGATTTTAAAGTTAAAGATAAAGTTGATCAAGATCACGACTTATCCCAATATAAGGGAAAGGTTGTTCTTGTAGTTAACACTGCTTCCAAATGTGGTTTCACCCCT
CAGTTTGATGGCTTAGAAAAGTTATACCAAAAGTACAAGGAAAGAAACGTTGTCGTATTAGGTTTCCCTTGTAATCAATTTGGCGGTCAAGACCCTGGAAGTCAAGAAGAAATTGAAAGT
TTCTGTAAAGTCAACTATGGTGTTACTTTCCCTATTTTGAAAAAGAT
TGAAGTTAATGGTGATAAGGTAGAGCCTTTATACGAATTCTTAAAAACAGAGAAGCCAGGTATTTTTGGTTTA
ACTAGAATTAAATGGAATTTTGAG
AAATTCTTAATCGATGCCAATGGAAAGGTTATTTCAAGATTCTCTAGTCTTGCAACCCCTCAAAGTATTGAATCAGAAATTGAACTATTACTCCCT
GCTGAAGAAAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAATTAAC ATTATGCCCT CATTTTACGA TTTTAAAGTT AAAGATAAAG TTGATCAAGA TCACGACTTA TCCCAATATA AGGGAAAGGT TGTTCTTGTA GTTAACACTG CTTCCAAATG  TGGTTTCACC CCTCAGTTTG ATGGCTTAGA AAAGTTATAC CAAAAGTACA AGGAAAGAAA CGTTGTCGTA TTAGGTTTCC CTTGTAATCA ATTTGGCGGT CAAGACCCTG GAAGTCAAGA  AGAAATTGAA AGTTTCTGTA AAGTCAACTA TGGTGTTACT TTCCCTATTT TGAAAAAGAT TGAAGTTAAT GGTGATAAGG TAGAGCCTTT ATACGAATTC TTAAAAACAG AGAAGCCAGG  TATTTTTGGT TTAACTAGAA TTAAATGGAA TTTTGAGAAA TTCTTAATCG ATGCCAATGG AAAGGTTATT TCAAGATTCT CTAGTCTTGC AACCCCTCAA AGTATTGAAT CAGAAATTGA 
ACTATTACTC CCTGCTGAAG AAAACTAGTT TTTCTATCAC AACTACAATA TGTTTATAAT AAATAACGCT GCTAC 

Retrieve as FASTA