Entry information : CcorGPx06
Entry ID 11834
Creation 2013-05-06 (Gisèle Passaia )
Last sequence changes 2016-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: CcorGPx06
Name CcorGPx06
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx06
start..stop
S start..stop
BaGPx01 186 1e-60 32..194 50..213
TganGPx01 183 6e-60 37..194 1..159
TvGPx01 185 8e-60 29..194 58..229
PbreGPx01 184 1e-59 38..194 68..225
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94..276 183 N° 2 327..535 209 N° 3 585..681 97 N° 4 736..831 96
join(94..276,327..535,585..681,736..831)


exon

Literature and cross-references CcorGPx06
Cluster/Prediction ref. JGI gene:   78850
Protein sequence: CcorGPx06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   195
PWM (Da):   %s   21994.36  
PI (pH):   %s   9.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRSTLLTTSNTLLKQNLLKSSIYKLNLRTMTNDTQVNSFYELKGTDINGNTFTFDRFKNKVVLIVNTACACGFTPQLKGLQELHDKYNTKGLEVVGFPSNSFNQDQAEGQELIDSYVNKHGVKFLLMQKSDVNGDNTNEVFKYLKSQKSGLLGTTFIKWNFKFLVDRNGEVVKRYSSKGTPEEIAKDIEPLL*

Retrieve as FASTA  
Remarks complete sequence from genomic (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTAAGAAGTACATTACTTACAACAAGCAATACTTTACTAAAGCAAAATTTACTAAAAAGCTCAATTTATAAGTTAAATTTAAGAACTATGACTAACGACACTCAAGTAAACTCTTTT
TACGAATTAAAAGGAACCGATATTAACGGAAATACCTTTACTTTTGACAGGTTTAAGAATAAG
GTAAGTCAGCAAACATAGCTAATTATAAATATTAACACTTATTGGTTTAGGTTGTAC
TTATTGTTAACACCGCCTGTGCATGTGGGTTCACTCCTCAACTAAAAGGACTTCAAGAACTCCACGACAAGTACAACACTAAAGGCTTAGAGGTTGTAGGGTTCCCTAGTAACTCTTTTA
ACCAAGACCAAGCAGAAGGTCAAGAACTTATTGACAGCTACGTCAACAAGCATGGTGTTAAGTTTTTGTTAATGCAAAAGAG
GTAAATTATTAATTTGAAATTGTTATTTTGTAATATTA
ATATTTGATAGTGACGTAAATGGAGATAATACCAATGAAGTATTCAAATATTTAAAGAGTCAAAAATCAGGATTATTGGGTACTACTTTTATTAAGTGGAACTTTGAAGTAAATTAATAT
CATTCACTCTCACTTTCAATTATTAATTAATTTTATTTTTAGAAATTCTTAGTTGATCGTAATGGTGAAGTAGTTAAGAGATACTCTTCCAAGGGCACTCCTGAAGAAATTGCAAAGGAT
ATTGAGCCCTTGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTAAGAAGTACATTACTTACAACAAGCAATACTTTACTAAAGCAAAATTTACTAAAAAGCTCAATTTATAAGTTAAATTTAAGAACTATGACTAACGACACTCAAGTAAACTCTTTT
TACGAATTAAAAGGAACCGATATTAACGGAAATACCTTTACTTTTGACAGGTTTAAGAATAAG
GTTGTACTTATTGTTAACACCGCCTGTGCATGTGGGTTCACTCCTCAACTAAAAGGA
CTTCAAGAACTCCACGACAAGTACAACACTAAAGGCTTAGAGGTTGTAGGGTTCCCTAGTAACTCTTTTAACCAAGACCAAGCAGAAGGTCAAGAACTTATTGACAGCTACGTCAACAAG
CATGGTGTTAAGTTTTTGTTAATGCAAAAGAG
TGACGTAAATGGAGATAATACCAATGAAGTATTCAAATATTTAAAGAGTCAAAAATCAGGATTATTGGGTACTACTTTTATTAAGTGG
AACTTTGAA
AAATTCTTAGTTGATCGTAATGGTGAAGTAGTTAAGAGATACTCTTCCAAGGGCACTCCTGAAGAAATTGCAAAGGATATTGAGCCCTTGTTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAATCTATA AAATTTAAAC TTATTGATGA TTAAACAAGG GTCTTTTCCA TTAGTATAAA AACTCTACCT ACGTCAGATA AGAAAAATTT AATATGTTAA GAAGTACATT ACTTACAACA  AGCAATACTT TACTAAAGCA AAATTTACTA AAAAGCTCAA TTTATAAGTT AAATTTAAGA ACTATGACTA ACGACACTCA AGTAAACTCT TTTTACGAAT TAAAAGGAAC CGATATTAAC  GGAAATACCT TTACTTTTGA CAGGTTTAAG AATAAGGTTG TACTTATTGT TAACACCGCC TGTGCATGTG GGTTCACTCC TCAACTAAAA GGACTTCAAG AACTCCACGA CAAGTACAAC  ACTAAAGGCT TAGAGGTTGT AGGGTTCCCT AGTAACTCTT TTAACCAAGA CCAAGCAGAA GGTCAAGAAC TTATTGACAG CTACGTCAAC AAGCATGGTG TTAAGTTTTT GTTAATGCAA  AAGAGTGACG TAAATGGAGA TAATACCAAT GAAGTATTCA AATATTTAAA GAGTCAAAAA TCAGGATTAT TGGGTACTAC TTTTATTAAG TGGAACTTTG AAAAATTCTT AGTTGATCGT 
AATGGTGAAG TAGTTAAGAG ATACTCTTCC AAGGGCACTC CTGAAGAAAT TGCAAAGGAT ATTGAGCCCT TGTTGTAATC AATTCTTTCT CTAATTGTAA TAATAAATTT TATTAGCTC 

Retrieve as FASTA