Entry information : ZcelGPx01
Entry ID 11845
Creation 2013-05-22 (Christophe Dunand)
Last sequence changes 2013-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: ZcelGPx01
Name ZcelGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Zasmidium
Organism Zasmidium cellare    [TaxId: 395010 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZcelGPx01
start..stop
S start..stop
MfiGPx01 350 5e-124 26..231 18..232
MpiGPx01 327 4e-115 22..231 11..222
CzmGPx 322 2e-113 4..213 3..201
MgGPx01 319 4e-112 6..214 5..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38521..38827 307 N° 2 38074..38459 386  
complement(join(38074..38459,38521..38827))


exon

Literature and cross-references ZcelGPx01
DNA ref. JGI genome:   scaffold_5 (38827..38074)
Cluster/Prediction ref. JGI gene:   35827 [Incorrect prediction]
Protein sequence: ZcelGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   25246.99  
PI (pH):   %s   9.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLVPRIAPTVASCAARTRGPAVSATHIRISSARLVSAVYINQPHTRSASMASATTFYDFKPKDKKGNEYPLTDLKGKVVLVVNTASKCGFTPQFEGLEKLYKDLKPSHPDFEIIGFPCNQFGNQDPGSNDDIQSFCQLNYGVTFPVLGKTDVNGDKAEPVWEWMKEQKPGIMGLKRIKWNFEKFLVGRDGKVKQRWASTSAPDKLKAAIEAELKASPGATATSAEKPTPT

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Incorrect prediction from JGI (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGTCCCTCGCATTGCCCCGACTGTAGCCTCTTGTGCCGCCCGAACCCGAGGCCCAGCAGTATCTGCTACTCATATCAGAATCTCGTCCGCCCGCTTAGTTTCTGCTGTATACATC
AACCAGCCACATACGAGATCTGCAAGTATGGCGTCCGCTACCACGTTCTACGACTTCAAGCCAAAGGACAAGAAGGGCAATGAGTACCCTCTCACCGACCTGAAGGGCAAGGTCGTGCTC
GTCGTCAACACTGCTTCCAAGTGTGGCTTCACGCCACAGTTCGAAGGCCTTGAGAAGCTCTACAAAG
GTGTGCCAAACCTACCGCACATCAGTATAACCTGACAGCTCACTGACGAGACT
GTTTACAGACCTCAAGCCCTCCCACCCCGACTTCGAAATCATCGGCTTCCCATGCAACCAGTTCGGCAACCAAGACCCCGGCAGCAACGATGACATCCAGAGCTTCTGCCAGCTCAACTA
CGGCGTCACCTTCCCAGTCCTCGGCAAGACGGACGTCAACGGCGACAAAGCCGAGCCTGTGTGGGAGTGGATGAAAGAGCAGAAGCCAGGCATCATGGGCCTCAAGAGGATCAAGTGGAA
CTTTGAGAAGTTTCTCGTCGGAAGAGATGGCAAGGTCAAGCAGCGATGGGCCAGCACCAGCGCTCCGGATAAGCTCAAGGCTGCTATCGAGGCCGAGTTGAAGGCTTCGCCTGGCGCTAC
AGCAACCTCTGCTGAGAAGCCTACCCCGACTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGTCCCTCGCATTGCCCCGACTGTAGCCTCTTGTGCCGCCCGAACCCGAGGCCCAGCAGTATCTGCTACTCATATCAGAATCTCGTCCGCCCGCTTAGTTTCTGCTGTATACATC
AACCAGCCACATACGAGATCTGCAAGTATGGCGTCCGCTACCACGTTCTACGACTTCAAGCCAAAGGACAAGAAGGGCAATGAGTACCCTCTCACCGACCTGAAGGGCAAGGTCGTGCTC
GTCGTCAACACTGCTTCCAAGTGTGGCTTCACGCCACAGTTCGAAGGCCTTGAGAAGCTCTACAAAG
ACCTCAAGCCCTCCCACCCCGACTTCGAAATCATCGGCTTCCCATGCAACCAG
TTCGGCAACCAAGACCCCGGCAGCAACGATGACATCCAGAGCTTCTGCCAGCTCAACTACGGCGTCACCTTCCCAGTCCTCGGCAAGACGGACGTCAACGGCGACAAAGCCGAGCCTGTG
TGGGAGTGGATGAAAGAGCAGAAGCCAGGCATCATGGGCCTCAAGAGGATCAAGTGGAACTTTGAGAAGTTTCTCGTCGGAAGAGATGGCAAGGTCAAGCAGCGATGGGCCAGCACCAGC
GCTCCGGATAAGCTCAAGGCTGCTATCGAGGCCGAGTTGAAGGCTTCGCCTGGCGCTACAGCAACCTCTGCTGAGAAGCCTACCCCGACTGCT

Retrieve as FASTA