Entry information : AresCcP01
Entry ID 11849
Creation 2013-05-22 (Christophe Dunand)
Last sequence changes 2013-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-24 (Catherine Mathe (Scipio))
Peroxidase information: AresCcP01
Name AresCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Amorphothecaceae Amorphotheca
Organism Amorphotheca resinae    [TaxId: 5101 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AresCcP01
start..stop
S start..stop
SsclCcP01 585 0 1..324 1..324
MvarCcP02 579 0 1..324 1..324
AmacrCcP02 574 0 1..324 1..323
MbicCcP01 573 0 1..324 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1493003..1493112 110 N° 2 1492086..1492950 865  
complement(join(1492086..1492950,1493003..1493112))


exon

Literature and cross-references AresCcP01
DNA ref. JGI genome:   scaffold_10 (1493112..1492086)
Cluster/Prediction ref. JGI gene:   21787
Protein sequence: AresCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325
PWM (Da):   %s   36147.11  
PI (pH):   %s   6.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQKGDFAAVRKDIVKLLHQPGYDDGSAGPILVRLAWHSSGTYDAETDTGGSNGAGMRYEAEGGDPANAGLQHARVFLESVKEKHPWITYADLWTYAGVVALEEMGGPAVPWKGGRTDYVDDSKIPPRGRLPDGAQGADHLRWIFYRMGFNDQEIVALSGAHNLGRCHADRSGFDGPWVNNPTRFSNQYFRLLLSLQWKKKTLPNGVQQFVNYDEDTETELMMLPTDIALTQDPSFRKWVEIYARDKDRFFADFAKVFEKLLELGIKRDEKGTITNTDNVKGGYHSAPKKKNTPGSPAKSSDDKVDVSEAEPLKDANKKFRARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCAGAAGGGCGACTTCGCAGCTGTCCGCAAGGATATCGTCAAGCTTCTTCATCAACCTGGCTATGATGATGGAAGCGCTGGCCCCATCCTCGTCCGGCTGGCTTGGTATGTCTTT
CTGATATGCTTCGTTTTCCATCTACTGACAAGCCTTTCTTAGGCACTCCTCTGGGACTTACGATGCCGAAACAGACACCGGCGGATCAAATGGCGCTGGCATGCGCTACGAAGCCGAAGG
TGGCGACCCTGCCAATGCCGGCCTTCAACATGCGCGCGTATTTCTCGAATCCGTAAAGGAGAAGCACCCGTGGATCACATACGCCGACCTCTGGACATATGCTGGTGTTGTAGCTCTCGA
GGAAATGGGCGGCCCCGCAGTCCCATGGAAAGGAGGTCGCACAGATTATGTCGATGACAGCAAAATTCCCCCTCGAGGACGGCTTCCCGACGGCGCCCAAGGCGCAGACCACCTCCGTTG
GATATTCTACCGCATGGGGTTCAACGACCAGGAAATCGTCGCGCTCTCAGGAGCACATAATCTCGGACGTTGTCACGCCGACCGATCGGGATTTGATGGTCCGTGGGTCAATAATCCAAC
GCGGTTCTCGAATCAGTACTTCCGATTACTCCTCTCCCTACAGTGGAAGAAGAAGACATTGCCGAACGGGGTGCAGCAGTTTGTGAACTATGATGAGGACACCGAAACCGAGCTGATGAT
GCTGCCAACGGACATTGCCCTGACCCAAGATCCGAGTTTCCGCAAATGGGTGGAAATATATGCTCGGGATAAGGATAGGTTCTTTGCCGATTTTGCCAAGGTTTTTGAGAAACTGCTTGA
GCTAGGCATTAAGAGAGATGAGAAAGGAACGATCACGAATACGGATAATGTGAAGGGCGGTTATCACTCTGCGCCAAAGAAGAAGAACACTCCAGGAAGTCCAGCGAAGAGCTCGGATGA
TAAAGTGGATGTGAGCGAAGCGGAGCCATTGAAAGATGCGAATAAAAAGTTCCGAGCGCGGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCAGAAGGGCGACTTCGCAGCTGTCCGCAAGGATATCGTCAAGCTTCTTCATCAACCTGGCTATGATGATGGAAGCGCTGGCCCCATCCTCGTCCGGCTGGCTTGGCACTCCTCT
GGGACTTACGATGCCGAAACAGACACCGGCGGATCAAATGGCGCTGGCATGCGCTACGAAGCCGAAGGTGGCGACCCTGCCAATGCCGGCCTTCAACATGCGCGCGTATTTCTCGAATCC
GTAAAGGAGAAGCACCCGTGGATCACATACGCCGACCTCTGGACATATGCTGGTGTTGTAGCTCTCGAGGAAATGGGCGGCCCCGCAGTCCCATGGAAAGGAGGTCGCACAGATTATGTC
GATGACAGCAAAATTCCCCCTCGAGGACGGCTTCCCGACGGCGCCCAAGGCGCAGACCACCTCCGTTGGATATTCTACCGCATGGGGTTCAACGACCAGGAAATCGTCGCGCTCTCAGGA
GCACATAATCTCGGACGTTGTCACGCCGACCGATCGGGATTTGATGGTCCGTGGGTCAATAATCCAACGCGGTTCTCGAATCAGTACTTCCGATTACTCCTCTCCCTACAGTGGAAGAAG
AAGACATTGCCGAACGGGGTGCAGCAGTTTGTGAACTATGATGAGGACACCGAAACCGAGCTGATGATGCTGCCAACGGACATTGCCCTGACCCAAGATCCGAGTTTCCGCAAATGGGTG
GAAATATATGCTCGGGATAAGGATAGGTTCTTTGCCGATTTTGCCAAGGTTTTTGAGAAACTGCTTGAGCTAGGCATTAAGAGAGATGAGAAAGGAACGATCACGAATACGGATAATGTG
AAGGGCGGTTATCACTCTGCGCCAAAGAAGAAGAACACTCCAGGAAGTCCAGCGAAGAGCTCGGATGATAAAGTGGATGTGAGCGAAGCGGAGCCATTGAAAGATGCGAATAAAAAGTTC
CGAGCGCGGCTGTGA

Retrieve as FASTA