Entry information : AresGPx01
Entry ID 11851
Creation 2013-05-22 (Christophe Dunand)
Last sequence changes 2013-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-24 (Catherine Mathe (Scipio))
Peroxidase information: AresGPx01
Name AresGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Amorphothecaceae Amorphotheca
Organism Amorphotheca resinae    [TaxId: 5101 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AresGPx01
start..stop
S start..stop
OmaiGPx01 310 3e-110 1..172 1..172
CgraGPx01 307 3e-108 1..165 69..233
AmacrGPx01 305 1e-107 1..172 53..224
ChigGPx01 306 1e-107 1..167 73..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1791846..1791888 43 N° 2 1791635..1791769 135 N° 3 1791206..1791543 338  
complement(join(1791206..1791543,1791635..1791769,1791846..1791888))


exon

Literature and cross-references AresGPx01
DNA ref. JGI genome:   scaffold_6 (1791888..1791206)
Cluster/Prediction ref. JGI gene:   140431
Protein sequence: AresGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   19200.85  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATSFYDFKPLDKKGEPVPLEDYKGKVVLVVNTASKCGFTPQYEGLEKLYKTIREKHGSDFQILGFPCNQFGGQEPGSDDDIQSFCQLNYGVTFPILGKTDVNGDKANPLFEWLKNEQPGLLGLKRVKWNFEKFLIGKDGKVKGRWASTTKPESLEAPILEELAKGKSE

Retrieve as FASTA  
Remarks Complete sequence from genomic (
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGCAACCAGCTTCTACGATTTCAAGCCTTTGGACAGTACGTGCCCCCCGCGCTCCCCCTCCCTCCCTCTTGAGAGAATCTCGAACTAAGACCACCCCCTTCTTCCCATCAGA
GAAAGGCGAGCCCGTTCCCCTCGAAGACTACAAAGGGAAAGTCGTGCTTGTCGTCAACACGGCCTCGAAATGCGGTTTCACGCCACAGTACGAAGGGCTCGAGAAGCTCTACAAGACCAT
TAGAGAGAAGCACG
GTTCGTAATCAGATTCCTCTCCTCTCCTTCCCTTCCCTTCCCTTCCCACCCTCTCCCAACCGTGCAAGCAACTGACGCGCCCTTCCTCAAGGCTCTGATTTCCAAA
TCCTCGGTTTCCCATGCAACCAGTTCGGCGGCCAGGAGCCCGGCTCCGACGACGACATCCAGTCCTTCTGCCAGCTGAACTACGGCGTCACGTTCCCCATCCTGGGCAAGACGGACGTTA
ATGGTGACAAGGCCAACCCGCTCTTCGAATGGTTGAAGAATGAGCAGCCGGGCCTGCTGGGCTTGAAGAGGGTCAAGTGGAACTTCGAGAAGTTCCTGATTGGCAAGGATGGGAAGGTCA
AGGGCAGATGGGCGAGCACTACGAAGCCTGAGAGCTTGGAGGCACCGATTTTGGAGGAGTTGGCCAAGGGGAAGAGCGAGTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGCAACCAGCTTCTACGATTTCAAGCCTTTGGACAAGAAAGGCGAGCCCGTTCCCCTCGAAGACTACAAAGGGAAAGTCGTGCTTGTCGTCAACACGGCCTCGAAATGCGGT
TTCACGCCACAGTACGAAGGGCTCGAGAAGCTCTACAAGACCATTAGAGAGAAGCACG
GCTCTGATTTCCAAATCCTCGGTTTCCCATGCAACCAGTTCGGCGGCCAGGAGCCCGGCTCC
GACGACGACATCCAGTCCTTCTGCCAGCTGAACTACGGCGTCACGTTCCCCATCCTGGGCAAGACGGACGTTAATGGTGACAAGGCCAACCCGCTCTTCGAATGGTTGAAGAATGAGCAG
CCGGGCCTGCTGGGCTTGAAGAGGGTCAAGTGGAACTTCGAGAAGTTCCTGATTGGCAAGGATGGGAAGGTCAAGGGCAGATGGGCGAGCACTACGAAGCCTGAGAGCTTGGAGGCACCG
ATTTTGGAGGAGTTGGCCAAGGGGAAGAGCGAGTTG

Retrieve as FASTA