Entry information : GmarCIIBC01
Entry ID 11871
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2016-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC01
Name GmarCIIBC01
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC01
start..stop
S start..stop
GmarCIIBC02 631 0 1..357 1..352
GmarCIIBC04 582 0 1..357 1..355
GmarCIIBC06 537 0 1..357 1..354
GmarCIIBC 526 0 1..357 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47195..47321 127 N° 2 47003..47137 135 N° 3 46843..46893 51 N° 4 46778..46790 13
N° 5 46657..46722 66 N° 6 46382..46598 217 N° 7 46316..46330 15 N° 8 46225..46265 41
N° 9 46002..46168 167 N° 10 45848..45942 95 N° 11 45706..45783 78 N° 12 45576..45644 69
complement(join(45576..45644,45706..45783,45848..45942,46002..46168,46225..46265 ,46316..46330,46382..46598,46657..46722,46778..46790,46843..46893,47003..47137,4 7195..47321))


exon

Literature and cross-references GmarCIIBC01
DNA ref. JGI genome:   scaffold_29 (47321..45576)
Cluster/Prediction ref. JGI gene:   75730
Protein sequence: GmarCIIBC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (335)
PWM (Da):   %s   37369.86 (34903.6)  
PI (pH):   %s   5.1 (4.94) Peptide Signal:   %s   cut: 23 range:23-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLNLFVSFALALSQVANAGLVKRVTCSTGHVTANAACCALFPIVDTLQAGLFDGAECGEEAHSALRIAFHDAIGFSLKGTAMLGGADGSILVFNKTETSFHANGGIDDIVDSQFPFFQQTGLSAGDFIHLAAAVGTANCPGAPRLKFFLGRPPPKAAAPDLTVPEPTDSVTAILARFADAGFSPREVVALLSSHTIAAADVVDVTIPGTPFDSTPHHFDGNFFLEVLLKGRLFPGAGPQTGEVLSPIAGEMRLQSDFAISQDSRTACFWQDMINDQTRIMTEFGAAMAKLQVLGQNTKNLIDCSDVVPVPVAMDGTVKIPASFTSKDIQVACAAQPFPKLATRTGPAPTVPPM*

Retrieve as FASTA  
Remarks Complete from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGCTCGTCTCAACTTATTCGTCTCCTTCGCGCTTGCACTCTCGCAGGTCGCCAATGCTGGCCTCGTAAAGCGCGTAACTTGCTCTACGGGCCACGTAACTGCGAATGCCGCC
TGCTGTG
GTCTGTGCCCCCCATCTTGACCACCGTCGATTGTCGTTAACACTATCCTTTCAACAGCCCTTTTCCCTATTGTTGACACCTTGCAAGCGGGTCTGTTCGACGGTGCCGAATGC
GGTGAAGAGGCCCATTCCGCTCTCCGAATTGCCTTCCATGACGCCATTGGATTCTCACTTAAAGGTACGGCCATGCTTG
GTGCCCATAATGCTTGCTTTCTAACTGAATTTTTATTATCC
CAGGCGGAAAGTTAGTCGCTTCTTCTAGTAGGTTATTGTGGACGTTTTACTGACATGACGCAGGGGAGGAGGTGCTGACGGCTCCATTTTGGTGTTCAACAAGACCGAGACTTCTTTCCG
TGCGTTCTGTTTTCCATATCATATTGTTGCGGTGCCTGATTCAACTTTCAGATGCAAATGGAGGGTAATTTGCATTTCTCCGTTTTCTACCCAACGAAGGCCTAACTATCTCCCCATAGA
ATTGATGATATTGTGGACAGCCAGTTCCCATTCTTCCAGCAGACGGGATTAAGTGCTGGTGATTT
GTGAGTATTCAATATTCATGAACCGTGATATTGATTTTCAATTTTATGCTATCCA
CAGCATCCACCTCGCCGCAGCTGTCGGCACAGCCAACTGTCCAGGCGCCCCGAGGCTCAAGTTCTTCCTCGGAAGGCCTCCACCGAAAGCTGCTGCTCCGGATCTTACGGTCCCAGAGCC
CACTGACAGCGTAACCGCCATTCTTGCTAGGTTCGCTGATGCTGGCTTCTCTCCTCGGGAGGTTGTTGCTCTGCTTTCATCCCATACTATCGCAGCTGCT
GTACGTGAACTGAATTAATA
TTTGCTCCGCATGACTGACTTTTAGTTATAGGATGTTGTTGATGTCGTACGTCTCATATCTCAAGGACAACTTTCCTTATTCTAAGCTTCTCGTAGACTATTCCCGGAACTCCGTTTGAT
TCCACTCCACATCACTT
GTGAGTGTTATTCATTTCCCTCGAGAACTCGCTGACGTTGTACTTTCAAAATTTAGTGATGGTAACTTTTTCCTCGAAGTCCTCCTGAAGGGGCGTCTGTTCC
CTGGTGCCGGCCCACAAACTGGAGAAGTTCTTTCTCCCATTGCTGGCGAGATGCGTCTCCAGAGCGACTTTGCCATCTCTCAGGATTCGAGGACTGCTTGCTTCTGGCAGGACATGATCA
GTAAGTACTTTTTGGTCGGACATCACAATGAATTGCTCACATGTTGTTCTTGCACATAGACGACCAAACCCGAATTATGACCGAGTTTGGTGCTGCAATGGCGAAGCTCCAGGTCTTAGG
ACAGAACACGAAGAACCTTATTGACTGCTCTGAC
GTGGGTTTTTTCCAATCTCGATAGCCAATTGGTTCTGATTCGCTTCCCTTTTCTATCTCTGTAGGTCGTACCAGTACCTGTCGCTA
TGGATGGTACTGTCAAGATCCCAGCCAGCTTCACAAGCAAAGATATTCAAGTTGCT
GTAAGTTCGACTCCAGTCTTACTTTCGATGGCAAATTCAATATCTATCCTTTCTATACCAGTGT
GCCGCTCAGCCATTCCCGAAACTTGCTACTCGCACTGGGCCTGCTCCCACCGTTCCTCCTATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGCTCGTCTCAACTTATTCGTCTCCTTCGCGCTTGCACTCTCGCAGGTCGCCAATGCTGGCCTCGTAAAGCGCGTAACTTGCTCTACGGGCCACGTAACTGCGAATGCCGCC
TGCTGTG
CCCTTTTCCCTATTGTTGACACCTTGCAAGCGGGTCTGTTCGACGGTGCCGAATGCGGTGAAGAGGCCCATTCCGCTCTCCGAATTGCCTTCCATGACGCCATTGGATTCTCA
CTTAAAGGTACGGCCATGCTTG
GAGGTGCTGACGGCTCCATTTTGGTGTTCAACAAGACCGAGACTTCTTTCCATGCAAATGGAGGAATTGATGATATTGTGGACAGCCAGTTCCCATTC
TTCCAGCAGACGGGATTAAGTGCTGGTGATTT
CATCCACCTCGCCGCAGCTGTCGGCACAGCCAACTGTCCAGGCGCCCCGAGGCTCAAGTTCTTCCTCGGAAGGCCTCCACCGAAAGCT
GCTGCTCCGGATCTTACGGTCCCAGAGCCCACTGACAGCGTAACCGCCATTCTTGCTAGGTTCGCTGATGCTGGCTTCTCTCCTCGGGAGGTTGTTGCTCTGCTTTCATCCCATACTATC
GCAGCTGCT
GATGTTGTTGATGTCACTATTCCCGGAACTCCGTTTGATTCCACTCCACATCACTTTGATGGTAACTTTTTCCTCGAAGTCCTCCTGAAGGGGCGTCTGTTCCCTGGTGCC
GGCCCACAAACTGGAGAAGTTCTTTCTCCCATTGCTGGCGAGATGCGTCTCCAGAGCGACTTTGCCATCTCTCAGGATTCGAGGACTGCTTGCTTCTGGCAGGACATGATCA
ACGACCAA
ACCCGAATTATGACCGAGTTTGGTGCTGCAATGGCGAAGCTCCAGGTCTTAGGACAGAACACGAAGAACCTTATTGACTGCTCTGAC
GTCGTACCAGTACCTGTCGCTATGGATGGTACT
GTCAAGATCCCAGCCAGCTTCACAAGCAAAGATATTCAAGTTGCT
TGTGCCGCTCAGCCATTCCCGAAACTTGCTACTCGCACTGGGCCTGCTCCCACCGTTCCTCCTATGTAA

Retrieve as FASTA