Entry information : GmarCIIBC02
Entry ID 11872
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2016-06-16 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC02
Name GmarCIIBC02
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC02
start..stop
S start..stop
GmarCIIBC01 631 0 1..352 1..357
GmarCIIBC04 571 0 1..352 1..355
GmarCIIBC 525 0 1..352 1..354
GmarCIIBC06 511 0 1..352 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 544206..544332 127 N° 2 544025..544148 124 N° 3 543860..543919 60 N° 4 543668..543733 66
N° 5 543394..543610 217 N° 6 543321..543335 15 N° 7 543228..543268 41 N° 8 543004..543170 167
N° 9 542847..542941 95 N° 10 542705..542782 78 N° 11 542583..542651 69  
complement(join(542583..542651,542705..542782,542847..542941,543004..543170,5432 28..543268,543321..543335,543394..543610,543668..543733,543860..543919,544025..5 44148,544206..544332))


exon

Literature and cross-references GmarCIIBC02
DNA ref. JGI genome:   scaffold_30 (544332..542583)
Cluster/Prediction ref. JGI gene:   75958
Protein sequence: GmarCIIBC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (330)
PWM (Da):   %s   36693.62 (34354.3)  
PI (pH):   %s   5.31 (5.10) Peptide Signal:   %s   cut: 23 range:23-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSLIVSVALAVSQVVNAGLVKRVTCSTGHVTANAACCALFPIVDTLQSGLFDGAQCGEEAHSALRIAFHDAIGFSLKGEGGGADGSILAFNLTETAFRAVDDIVASQFPFFVQSGLSAGDFVHLAAAVGTANCPGAPRLKFFLGRPAPKAPAPDKTVPEPTDSVTSILARFADAGFSPREVVGLLASHTIAAADVIDASIPGTPFDSTPHHFDGNFFLEVLLKGRLFPGAGPQTGEVLSPIAGEMRLQSDFAISQDSRTACFWQDMINDQSRLMTEFSNAMAKLQVLGQNTKTLIDCSDVVPVPATMDGTVRIPASFTSKDIQVACPAQAFPKLATRTGPAPTVPPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTCGTCTCAGCTTGATCGTCTCAGTTGCACTCGCCGTATCCCAGGTCGTTAATGCTGGCCTCGTCAAGCGCGTAACTTGTTCTACTGGCCACGTAACAGCGAACGCAGCC
TGCTGTG
GTTTGTGTATTCTCTTTGAACGCTGTTTAACCTCGTTAATTATTTTACGCTCTTTAGCCCTATTCCCGATCGTTGACACTCTGCAATCGGGTCTCTTCGACGGCGCTCAGTGC
GGTGAAGAGGCTCACTCGGCTCTTCGAATCGCGTTCCACGACGCCATTGGATTCTCACTCAAAGGTGA
GTTAGCAGTAAACGTGCCAGATTAATCTCATTGCTTTTGATATAGGCGGATT
GTTTGTTGCTTTTCGTTATTAAGTTGCCACAAACCTCTCACCATTTTTTATAGGGGAGGAGGTGCTGATGGATCTATCCTGGCATTCAACTTAACCGAGACTGCATTCCGTGCGTTCAAA
CTTTCGAACTTGATATCTTGAATCCCAGCTCATTAAGTCAACCTTCAGATGCTAACGGAGGGTAAATTTCCTCATTTGCTCTTTCTCAAAGAACCGCGTAGTGATTGGGACTTTTTTAGC
GTTGACGATATCGTCGCCAGTCAATTCCCGTTCTTCGTGCAGTCAGGATTATCTGCTGGAGATTT
GTGCGTATATTCTTTTTGTTCATGGATACTGGGCATTGATTGTCATAAACCTTTC
AGCGTCCACCTTGCCGCAGCGGTTGGCACAGCCAACTGCCCCGGAGCACCGAGGCTCAAGTTCTTCCTTGGCCGACCTGCACCGAAAGCTCCCGCTCCTGATAAGACAGTCCCGGAACCC
ACGGACAGCGTGACCTCCATCCTTGCTAGGTTCGCCGATGCTGGGTTCTCTCCCCGAGAGGTTGTTGGTTTGCTTGCCTCGCACACCATTGCCGCTGCC
GTAAGTGAATTTCGCACCCTT
TCATTCAACCCTATTTAAATATTTTTCGTGCTTATAGGATGTCATCGACGCGGTAAATTTATTGGTTCCTCTATTATCTTCCCAGTTCCTAACTTCTCTCGTAGTCAATTCCAGGAACTC
CGTTTGATTCCACTCCTCATCATTT
GTGAGTGCTAAGTAAGCCGTCCATCGGAGAGTGTACTAATGTGCCCACTCTAATCAGCGACGGTAACTTCTTCCTCGAAGTTCTCTTAAAAGGGC
GCCTCTTCCCAGGAGCTGGCCCCCAGACCGGAGAAGTCCTTTCTCCCATCGCTGGTGAGATGCGCCTGCAGAGCGACTTTGCCATCTCCCAGGATTCCAGGACTGCTTGCTTCTGGCAGG
ACATGATCA
GTGAGTACATTTCAGCACGTCGGTCATGTCACAGTCCACTTACTGCCCGATGTTGGAAACAGATGACCAAAGCCGCCTCATGACCGAATTCAGTAATGCCATGGCGAAGCT
CCAAGTGTTAGGACAGAACACGAAGACTCTTATTGATTGCTCTGAC
GTGGGTTTTATTTCAATACGCACCGGTAGTTATTGAAGTTCACACATCGTTTCTATCACTACAGGTCGTCCCAG
TTCCCGCGACGATGGATGGCACCGTTAGAATCCCAGCCAGCTTCACTAGCAAGGATATTCAAGTCGCT
GTAAGCTTATTTCACCCTTTTATCTGGCCAACTATCCATGCATTCTATCTTA
GTGCCCAGCCCAAGCATTCCCAAAACTTGCTACCCGAACTGGACCTGCTCCAACCGTTCCCCCTGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTCGTCTCAGCTTGATCGTCTCAGTTGCACTCGCCGTATCCCAGGTCGTTAATGCTGGCCTCGTCAAGCGCGTAACTTGTTCTACTGGCCACGTAACAGCGAACGCAGCC
TGCTGTG
CCCTATTCCCGATCGTTGACACTCTGCAATCGGGTCTCTTCGACGGCGCTCAGTGCGGTGAAGAGGCTCACTCGGCTCTTCGAATCGCGTTCCACGACGCCATTGGATTCTCA
CTCAAAGGTGA
GGGAGGAGGTGCTGATGGATCTATCCTGGCATTCAACTTAACCGAGACTGCATTCCGTGCCGTTGACGATATCGTCGCCAGTCAATTCCCGTTCTTCGTGCAGTCAGGA
TTATCTGCTGGAGATTT
CGTCCACCTTGCCGCAGCGGTTGGCACAGCCAACTGCCCCGGAGCACCGAGGCTCAAGTTCTTCCTTGGCCGACCTGCACCGAAAGCTCCCGCTCCTGATAAG
ACAGTCCCGGAACCCACGGACAGCGTGACCTCCATCCTTGCTAGGTTCGCCGATGCTGGGTTCTCTCCCCGAGAGGTTGTTGGTTTGCTTGCCTCGCACACCATTGCCGCTGCC
GATGTC
ATCGACGCG
TCAATTCCAGGAACTCCGTTTGATTCCACTCCTCATCATTTCGACGGTAACTTCTTCCTCGAAGTTCTCTTAAAAGGGCGCCTCTTCCCAGGAGCTGGCCCCCAGACCGGA
GAAGTCCTTTCTCCCATCGCTGGTGAGATGCGCCTGCAGAGCGACTTTGCCATCTCCCAGGATTCCAGGACTGCTTGCTTCTGGCAGGACATGATCA
ATGACCAAAGCCGCCTCATGACC
GAATTCAGTAATGCCATGGCGAAGCTCCAAGTGTTAGGACAGAACACGAAGACTCTTATTGATTGCTCTGAC
GTCGTCCCAGTTCCCGCGACGATGGATGGCACCGTTAGAATCCCAGCC
AGCTTCACTAGCAAGGATATTCAAGTCGCT
TGCCCAGCCCAAGCATTCCCAAAACTTGCTACCCGAACTGGACCTGCTCCAACCGTTCCCCCTGTGTAA

Retrieve as FASTA