Entry information : GmarCIIBC03
Entry ID 11873
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2016-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2017-04-27 (Catherine Mathe)
Peroxidase information: GmarCIIBC03
Name GmarCIIBC03
Class Other class II peroxidase type C    [Orthogroup: CIIBC002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC03
start..stop
S start..stop
GmarCIIBC16 531 0 1..358 1..344
GmarCIIBC11 516 0 3..358 4..358
GmarCIIBC15 511 0 1..358 1..349
GmarCIIBC08 492 4e-176 1..359 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 469927..470059 133 N° 2 470120..470184 65 N° 3 470243..470301 59 N° 4 470443..470498 56
N° 5 470563..470575 13 N° 6 470630..470695 66 N° 7 470763..470884 122 N° 8 470952..471069 118
N° 9 471200..471235 36 N° 10 471352..471402 51 N° 11 471473..471552 80 N° 12 471606..471641 36
N° 13 471701..471795 95 N° 14 471870..471947 78 N° 15 472019..472099 81  
join(469927..470059,470120..470184,470243..470301,470443..470498,470563..470575, 470630..470695,470763..470884,470952..471069,471200..471235,471352..471402,47147 3..471552,471606..471641,471701..471795,471870..471947,472019..472099)


exon

Literature and cross-references GmarCIIBC03
DNA ref. JGI genome:   scaffold_38 (469927..472099)
Cluster/Prediction ref. JGI gene:   104378
Protein sequence: GmarCIIBC03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (340)
PWM (Da):   %s   37961.96 (35490.6)  
PI (pH):   %s   4.4 (4.27) Peptide Signal:   %s   cut: 23 range:23-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKRIAVLMALAISQLQPGNAASIQKRSVTCPTGQTTANEACCVLFPVVDLLQKELFDNGQCDEEAHAALRLAFHDAIGFSNSGKGGGADGSILAFNSTETAYDANAGIDDIVALQWPLFLKSNLTAGDFVHLAAAVGTANCPGTPQLPYSFGRPPPVAPAPDLTVPQPTDSVTTILARFAEAGFVAPEVIWLLASHSIAAAVRTSTSLPPGTAFDSCVIFSDTQFYLEVLLNGTQFPGSGEKSGEVPSALAGEMRLASDFAFSQDSRTACFWQEAIDDQPFIMGKFEAAMAKLQVLGQSGFRLTDCSDVIPVPKAFSGPIRYPASFNQTNVQIACTSTPFPSLATVAGPAPTIPPVSVTF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns). Problem with an incorrect intron splice site
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAACGAATTGCCGTCCTGATGGCTCTCGCCATCTCTCAACTCCAACCTGGAAACGCCGCCTCCATCCAGAAGCGTTCTGTTACCTGTCCAACGGGACAGACAACCGCCAAC
GAGGCGTGCTGTG
GTGCGCAATACATTACATGTCATAAATTCGGAGGAGCTACTAACGCCCGTTTCGATACAGTCCTCTTCCCTGTCGTTGACCTGCTTCAAAAGGAGCTTTTCGACAAT
GGACAATGTGATGAAGAG
GTCAGCGCTAATTAAAAATGTTTTTGAATTTCAATATTCAGCATTGGTTTTTTTGCAGGCTCATGCAGCCCTCCGCCTCGCGTTCCATGATGCCATAGGTTT
TTCGAACAGCGGTAA
GTCAATTTACAGATTCCCATGTTCTCAGACTCAAATAATACCCGTCCATCTCAGGTGGAAAGTCAGTATTTTGACACTTGTGACAAACGAACCCACTCTGTCGAA
CACTCACTAATTTCGCGTTGTACTTACATTTACAAGGGGAGGAGGCGCTGACGGATCCATCCTCGCTTTCAATTCTACGGAAACTGCATACGGTGAGATAATAGGATCTTATATCCACTT
TATCCTAGAATTCAAACAATCACTCCGTTTCAATAGATGCCAATGCCGGGTGAATAGCTGCCTCTCTTCTTAAAAAAAACTATCTTAACCTTCCACCCAACAGTATCGACGACATCGTTG
CTCTTCAATGGCCACTCTTCCTCAAAAGCAATCTAACTGCTGGAGACTT
GTATGTATCAAAACTTTGTTATATATCAAAGATAGCCACGATTCATACTTGTATCTCCCTTGCTCAGCGTC
CATCTCGCAGCAGCCGTTGGGACCGCAAATTGTCCTGGTACACCTCAACTCCCGTATTCTTTCGGTCGCCCACCACCTGTCGCACCTGCCCCTGATCTTACCGTGCCTCAACCGACTG
GT
GCGTTGTACCATGATCGCGAGTTATAAATAATCTTAACTTGGACCTGTTAAACCCCTGTGTCTAGATAGTGTCACCACCATCCTTGCGCGGTTCGCAGAAGCCGGATTCGTCGCTCCAGA
AGTGATCTGGCTTCTTGCTTCGCACTCCATCGCCGCTGCGGTACGTACTTCTACGTCCCTTCC
GTGATTTTGAGAGGTTTGGAATTCTAATTTCTGCATGGTCGCTTCCAGAACAAAGTT
GATCCAGTAAGTAAAATTTCAATGAGGTTGAGACCGTTGAGTCCTAAGCTAATGGTCATGAAATTCAGGCCAGGCCCGGAACCGCATTCGATTCGTGCGTGATTTTCTCGTAGCGAATTA
AACTGCATTTTGATCAGGACATCTAATACTCAGGACGCCTAATGTCTTGTAAGTTCACCTTCGCCTTGTTATTAACTTACAATTTTCGACCTAGCTCGTTTTCAGTGACACTCAGTTTTA
CCTCGAAGTACTCCTGAACGGAACCCAATTCCCAGG
GCAAGTGACAGTAATTACTTTTCGTGCAGAGATCAAGTGATCTAATCGCCCCTTTACTTAATCTCAACAGAAGCGGCGAAAAAT
CTGGTGAAGTTCCGTCCGCACTCGCAGGAGAAATGCGCCTGGCGAGTGACTTCGCGTTTTCTCAAG
GTTCGCGTTCCTCCTCTCTCCGTGTGCCCCTATATCCTAACTTATATGCCTAGA
TTCGCGGACTGCTTGTTTCTGGCAGGAGGCGATCG
GAAAGTTGCTTCCTATTTTAACACTATACATCTCAACTTACTTTCAATGTCAATTTTAGATGACCAGCCGTTTATCATGGGCAAA
TTCGAAGCGGCAATGGCGAAACTTCAAGTTCTGGGTCAAAGTGGGTTCAGGTTGACAGATTGCTCCGAT
GTTCGTATACTCTTTCTTCCAGAGCCTCATCTAGTGAAAACTTCTTTCTTC
TAACCTGATCGTGGCACCTTTAGGTCATCCCAGTTCCAAAGGCCTTCTCCGGTCCCATCCGCTATCCAGCCAGCTTCAACCAAACCAACGTTCAGATCGCCGTATGTACATCCCTTGACA
CCCAATATTAAACAGGCTCAACTGAGTTTCCACTCATACTTGCTTACCATAGTGCACTTCAACTCCGTTCCCAAGCCTCGCAACAGTAGCTGGTCCTGCTCCCACCATTCCTCCGGTGTC
AGTCACATTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAACGAATTGCCGTCCTGATGGCTCTCGCCATCTCTCAACTCCAACCTGGAAACGCCGCCTCCATCCAGAAGCGTTCTGTTACCTGTCCAACGGGACAGACAACCGCCAAC
GAGGCGTGCTGTG
TCCTCTTCCCTGTCGTTGACCTGCTTCAAAAGGAGCTTTTCGACAATGGACAATGTGATGAAGAGGCTCATGCAGCCCTCCGCCTCGCGTTCCATGATGCCATAGGT
TTTTCGAACAGCGGTAA
GGGAGGAGGCGCTGACGGATCCATCCTCGCTTTCAATTCTACGGAAACTGCATACGATGCCAATGCCGGTATCGACGACATCGTTGCTCTTCAATGGCCACTC
TTCCTCAAAAGCAATCTAACTGCTGGAGACTT
CGTCCATCTCGCAGCAGCCGTTGGGACCGCAAATTGTCCTGGTACACCTCAACTCCCGTATTCTTTCGGTCGCCCACCACCTGTCGCA
CCTGCCCCTGATCTTACCGTGCCTCAACCGACTG
ATAGTGTCACCACCATCCTTGCGCGGTTCGCAGAAGCCGGATTCGTCGCTCCAGAAGTGATCTGGCTTCTTGCTTCGCACTCCATC
GCCGCTGCGGTACGTACTTCTACGTCCCTTCC
GCCCGGAACCGCATTCGATTCGTGCGTGATTTTCTCTGACACTCAGTTTTACCTCGAAGTACTCCTGAACGGAACCCAATTCCCAGGA
AGCGGCGAAAAATCTGGTGAAGTTCCGTCCGCACTCGCAGGAGAAATGCGCCTGGCGAGTGACTTCGCGTTTTCTCAAG
ATTCGCGGACTGCTTGTTTCTGGCAGGAGGCGATCGATGAC
CAGCCGTTTATCATGGGCAAATTCGAAGCGGCAATGGCGAAACTTCAAGTTCTGGGTCAAAGTGGGTTCAGGTTGACAGATTGCTCCGAT
GTCATCCCAGTTCCAAAGGCCTTCTCCGGT
CCCATCCGCTATCCAGCCAGCTTCAACCAAACCAACGTTCAGATCGCC
TGCACTTCAACTCCGTTCCCAAGCCTCGCAACAGTAGCTGGTCCTGCTCCCACCATTCCTCCGGTGTCAGTC
ACATTTTAA

Retrieve as FASTA