Entry information : GmarCIIBC08
Entry ID 11880
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2016-06-29 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC08
Name GmarCIIBC08
Class Other class II peroxidase type C    [Orthogroup: CIIBC002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC08
start..stop
S start..stop
GmarCIIBC16 526 0 1..348 1..344
GmarCIIBC03 513 0 1..349 1..359
GmarCIIBC15 509 0 1..348 1..349
GmarCIIBC05 473 1e-168 1..351 1..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 340592..340687 96 N° 2 340405..340537 133 N° 3 340332..340338 7 N° 4 340224..340279 56
N° 5 340157..340169 13 N° 6 340038..340103 66 N° 7 339862..339983 122 N° 8 339713..339807 95
N° 9 339637..339651 15 N° 10 339552..339577 26 N° 11 339480..339494 15 N° 12 339370..339426 57
N° 13 339241..339317 77 N° 14 339152..339187 36 N° 15 339007..339095 89 N° 16 338878..338955 78
N° 17 338752..338816 65 N° 18 338623..338683 61  
complement(join(338623..338683,338752..338816,338878..338955,339007..339095,3391 52..339187,339241..339317,339370..339426,339480..339494,339552..339577,339637..3 39651,339713..339807,339862..339983,340038..340103,340157..340169,340224..340279 ,340332..340338,340405..340537,340592..340687))


exon

Literature and cross-references GmarCIIBC08
DNA ref. JGI genome:   scaffold_49 (340687..338623)
Cluster/Prediction ref. JGI gene:   147216
Protein sequence: GmarCIIBC08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (347)
PWM (Da):   %s   38312.48 (36205.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.82 (4.62) Peptide Signal:   %s   cut: 21 range:21-367
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFGRLAVLVVLLASHLAAAVTCPGGQVVANKVCCKLFPVIKLLQADLFDGGECGEEAHAALRLAFHDAIGFSTSGGKGGGADGSILAFNKTETKYAANDGIDDIVAAQWPIFLQSNLSAGDFVHLAGAIGTGNCPGAPLLPYSMGRPPPVAPAPDLTVPQPTDSVTKILARFADAGFVPAEVIWLLASHSIADANKLDPSIPGTPFDSTPFTFDTQFYLEVLLKGTRTPGPGPLKDGEVLSPLAGEMRLKSDFAFSQDNRTACFWQEAINDQPFIMARFHDAMQKLQLLGQTGLTDCSDAIPVPKTFAGPIKYPASFSQANLKIACLSTPFPSIATVAGPAPTIPPVSGASDTQQTTAEPLALPFS*

Retrieve as FASTA  
Remarks complete sequence from genomic (17 introns). Incorrect prediction from JGI
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTGGCCGTCTCGCCGTGCTCGTCGTACTTCTCGCATCTCACCTGGCAGCCGCAGTCACCTGTCCTGGTGGGCAAGTGGTGGCTAATAAAGTATGCTGCAGTGAGTTTTACTCG
TATTATATTTAAGCTTGCAGACTGTCTAAGGTCACTTCTTTAGAGTTGTTTCCCGTTATCAAGCTTCTTCAAGCGGACCTTTTTGATGGCGGTGAATGCGGTGAGGAAGCTCATGCTGCC
CTTCGCCTTGCCTTCCATGATGCCATTGGCTTCTCCACGAGTG
GTACGCCCTTTCTCGTGATAATACGTCTGAATCAGCAGATAATAATAGCTTTTATCAATCTTTTAGGCGGAAAGTTG
GTATCCTAACTTTTTTTCTTAATTGGTGATTCTCATAGACTTCGTTAGGGGTGGAGGCGCTGACGGTTCCATTCTTGCTTTCAATAAAACGGAGACCAAATACGGTTCGTAATAAACTCA
TTTATGTCATCTTTTTTACCAGCTAAGTTAACCCGCAGCTGCTAACGACGGGTACGCATCCCGTTCTAACTACAAGTGCAGGCTTCCTAATAATTTATCCCTAGCATTGACGACATCGTT
GCCGCACAGTGGCCAATCTTTCTTCAAAGTAACTTAAGCGCTGGAGACTT
GTAGGCAGTCTGTTCCTGCATTTCAAATAAATATCGCTCACCTGGGCTATACAGTGTCCATCTCGCGGGT
GCTATTGGAACAGGGAACTGCCCGGGAGCACCGCTTCTCCCTTATTCCATGGGTCGCCCACCCCCGGTTGCGCCTGCTCCTGACCTTACCGTACCTCAGCCAACAG
GTAAGTCAGGACAC
AACCATCCGCAATGAATGCTAATGCCATTTTTTTTCAAAGACAGTGTCACCAAAATTCTAGCAAGGTTTGCCGATGCAGGCTTCGTTCCAGCGGAGGTAATTTGGCTCCTCGCTTCGCAC
TCGATTGCTGACGCA
GTAAGTTGAAAATCTATCTTGGCCTTGGACGACTTTGTGCTTATATGATACTATTCATCAGAACAAACTGGATCCTGTATGTTTTCCATGACCACACTTACGATA
GGTCGGGCAAACTAAAGATCATAATTTCAGTCAATCCCAGGAACTCCATTCGATTCGTAAGTGAAAATTCCCTGTGTTAAGGATCGTCTCAAATTTTGAATGCATCTCAAAAGAACACCG
TTTACGTT
GTACGTCCAACATGATATTGTTCTCTGAAGGACATTTCTCCAATTCCTTTCAGTGACACACAATTTTACCTCGAGGTGCTCCTGAAAGGCACTCGCACCCCTGGGCCAGGGT
ATGTTAATTGCATTTACAGTCAGACTAATTCAGTTAAATCAATTATTCAGACCGTTGAAGGATGGCGAAGTCCTATCACCACTGGCCGGAGAAATGCGTCTGAAGAGTGATTTCGCCTTC
TCTCAAG
GTTTCTTTCTCAGTCATTCATCCTGCCTCACAAACCCTAACGTGGAATTCTAGATAACAGGACCGCTTGCTTCTGGCAAGAGGCTATTAGTATGTTTATTTCTACTCAATTCC
ACTTGATCTCCAGAATAACGATTCATTTACAGACGACCAACCATTCATCATGGCAAGGTTCCATGACGCGATGCAGAAGTTACAGCTCCTCGGTCAAACTGGGCTGACAGACTGCTCCGA
T
GTATTTACTTCCAATTTCGTAAAGGATGCCATATTCATATGATGTCTTTAGGCCATCCCCGTCCCCAAAACCTTCGCCGGACCAATCAAGTACCCAGCTAGCTTCAGTCAGGCCAACCT
TAAAATTGCC
GTGAGTGTTTAGTTGATAGGCTTGGATAGGCTGGATCTGAGCATTCGATGTTGTGATTCAGTGCCTGTCAACGCCTTTCCCGAGCATTGCAACTGTCGCTGGTCCTGCAC
CCACTATCCCTCCTGT
GTTAGTTTATTTTACTTCTTTCTCTCCTTCGAGACTAATATCCGGGCGATTACAGTCCACCTGCGTAGAAGCGGTGCTAGTGATACCCAGCAAACTACTGCAGA
ACCACTTGCGTTGCCGTTTTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTGGCCGTCTCGCCGTGCTCGTCGTACTTCTCGCATCTCACCTGGCAGCCGCAGTCACCTGTCCTGGTGGGCAAGTGGTGGCTAATAAAGTCACTTCTTTAGAGTTGTTTCCC
GTTATCAAGCTTCTTCAAGCGGACCTTTTTGATGGCGGTGAATGCGGTGAGGAAGCTCATGCTGCCCTTCGCCTTGCCTTCCATGATGCCATTGGCTTCTCCACGAGTG
GCGGAAAGGGT
GGAGGCGCTGACGGTTCCATTCTTGCTTTCAATAAAACGGAGACCAAATACG
CTGCTAACGACGGCATTGACGACATCGTTGCCGCACAGTGGCCAATCTTTCTTCAAAGTAACTTAAGC
GCTGGAGACTT
TGTCCATCTCGCGGGTGCTATTGGAACAGGGAACTGCCCGGGAGCACCGCTTCTCCCTTATTCCATGGGTCGCCCACCCCCGGTTGCGCCTGCTCCTGACCTTACCGTA
CCTCAGCCAACAG
ACAGTGTCACCAAAATTCTAGCAAGGTTTGCCGATGCAGGCTTCGTTCCAGCGGAGGTAATTTGGCTCCTCGCTTCGCACTCGATTGCTGACGCAAACAAACTGGAT
CCT
TCAATCCCAGGAACTCCATTCGATTCAACACCGTTTACGTTTGACACACAATTTTACCTCGAGGTGCTCCTGAAAGGCACTCGCACCCCTGGGCCAGGACCGTTGAAGGATGGCGAA
GTCCTATCACCACTGGCCGGAGAAATGCGTCTGAAGAGTGATTTCGCCTTCTCTCAAG
ATAACAGGACCGCTTGCTTCTGGCAAGAGGCTATTAACGACCAACCATTCATCATGGCAAGG
TTCCATGACGCGATGCAGAAGTTACAGCTCCTCGGTCAAACTGGGCTGACAGACTGCTCCGAT
GCCATCCCCGTCCCCAAAACCTTCGCCGGACCAATCAAGTACCCAGCTAGCTTCAGT
CAGGCCAACCTTAAAATTGCC
TGCCTGTCAACGCCTTTCCCGAGCATTGCAACTGTCGCTGGTCCTGCACCCACTATCCCTCCTGTAAGCGGTGCTAGTGATACCCAGCAAACTACTGCA
GAACCACTTGCGTTGCCGTTTTCCTGA

Retrieve as FASTA