Entry information : GmarCIIBC09
Entry ID 11881
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2016-03-10 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC09
Name GmarCIIBC09
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC09
start..stop
S start..stop
GmarCIIBC06 602 0 1..356 1..354
GmarCIIBC 600 0 1..356 1..354
GmarCIIBC12 598 0 1..356 1..354
GmarCIIBC07 597 0 1..359 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 228820..228946 127 N° 2 228700..228764 65 N° 3 228585..228646 62 N° 4 228479..228534 56
N° 5 228409..228421 13 N° 6 228292..228357 66 N° 7 228024..228240 217 N° 8 227929..227969 41
N° 9 227854..227868 15 N° 10 227631..227797 167 N° 11 227487..227581 95 N° 12 227341..227418 78
N° 13 227227..227291 65 N° 14 227153..227165 13  
complement(join(227153..227165,227227..227291,227341..227418,227487..227581,2276 31..227797,227854..227868,227929..227969,228024..228240,228292..228357,228409..2 28421,228479..228534,228585..228646,228700..228764,228820..228946))


exon

Literature and cross-references GmarCIIBC09
DNA ref. JGI genome:   scaffold_38 (228946..227153)
Cluster/Prediction ref. JGI gene:   145790
Protein sequence: GmarCIIBC09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (337)
PWM (Da):   %s   37497.01 (35219.8)  
PI (pH):   %s   5.89 (5.59) Peptide Signal:   %s   cut: 23 range:23-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSAIVAIAFAVSQSANAALTKRVTCASGHVTANAACCALFPMVDKLQTDLFDGGDCGEEAHSALRLSFHDAIGFSIHGGKGGGADGSILIFNKTELAFHANGGIDDITARQFPVFQELKLSPGDFVHLAAAVGTANCPGAPRLEFMFGRPAPKAPAPDLTVPEPTDSVTKILARFADAGFSPEEAVSLLSSHTIAAADVVDPTIPGTPFDSTVGTFDTQVFLEVLLKGNSFPGNGSQSGEVLSPLAGEMRLQSDFVISQDPRTACLWQARVNNQQLMVSSFKSAMAKLQTLGQNRARLIDCSDVVPVPKPFTANIKFPATFSRKDVQIACPQLPFPSLATVAGPAPTVPPVPGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic ( 13 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCCCGCCTGTCAGCTATCGTCGCAATTGCCTTCGCGGTATCCCAATCCGCTAATGCTGCCCTGACCAAGCGCGTTACTTGCGCCTCTGGTCATGTTACAGCCAATGCTGCG
TGCTGCG
GTATGTGGATCCAATAGCTACCCGGTCATTCAAATATTCAAATATTTATTTTCAGCCCTATTCCCAATGGTTGACAAGCTTCAAACGGACCTCTTTGACGGCGGTGACTGCGG
CGAAGAG
GTGGGCATTGTCATGAATATCTCGCCTAGGTACTGATGCTTTACTATTACTAGGCTCACTCAGCTCTGCGCCTGTCATTCCATGATGCTATTGGCTTCTCGATTCATGGTGGA
AA
GTAAGTCTGGACAACCATCTTCATTTTCGAAAGCTTATTGGGTATTGCAGGGGAGGAGGCGCTGACGGTTCTATTCTCATTTTCAACAAGACGGAACTAGCATTCCGTGAGTTTTATA
TTTTAAAGTAGAAATCGCGACATATTGTCTAATTACTCTCTACAGATGCCAACGGAGGGTAAAACCACTCGTCCTAAGCCTTTGATCAATATCTGACCCATGATATTAGTATCGACGATA
TCACTGCTCGGCAATTCCCCGTTTTCCAGGAGCTTAAATTGAGCCCCGGTGACTT
GTAAGTCTTCTTAATGGTTACTGAGTGCTTAACGCTACAACGACTACGCAGTGTCCATCTTGCCG
CAGCTGTGGGCACAGCCAACTGCCCCGGAGCACCTAGGCTCGAATTCATGTTTGGTCGTCCCGCTCCCAAAGCTCCTGCTCCAGATTTGACGGTGCCTGAGCCGACGGACAGCGTCACCA
AGATTCTTGCGAGGTTCGCTGACGCCGGCTTCTCTCCAGAAGAGGCCGTTTCACTTCTCTCGTCCCACACCATTGCCGCTGCT
GTGTGTTGGTTTCCTTCTATGATAATATCCATATTGA
CATAAATTTAATGCTAGGATGTGGTTGACCCAACCATTCCGGGAACTCCTTTCGACTCGTAAGTGTCGTAGTTCCTCCCTTTTTTATGGTTGCTAACCCTTTTGTTACTGCCACGCAGCA
CTGTCGGTACTTT
GTGAGTGAAAGATGATATCTTCTTAAAGACATTTGTACTCATACGATGACGATCAGCGACACTCAAGTCTTCCTTGAGGTTCTTCTTAAGGGTAATTCCTTCCCCGG
AAATGGCTCTCAATCCGGAGAGGTTCTGTCGCCTTTGGCAGGAGAGATGCGTCTACAAAGCGACTTCGTTATCTCCCAGGATCCAAGGACGGCTTGCTTATGGCAGGCGCGAGTTA
GTGA
GTCGTAAGTTTCGTGGATGGAATTCGCGGGATAACCTCGGAAAAGACAACCAGCAGCTCATGGTATCCTCATTCAAATCTGCCATGGCGAAGCTCCAAACTCTCGGGCAGAACAGAGCTA
GATTGATCGACTGCTCTGAC
GTACGTCCGCCACTTTTACCTCGACCCCATGTCAGATTCAGTCAAACTCACCGAAATCTCTATTTTAGGTCGTTCCCGTCCCGAAGCCATTCACAGCTAA
CATCAAGTTCCCGGCAACATTCTCGAGGAAGGATGTTCAAATCGCG
GTATGTCCTGTAAAACGTTCGAATTGTTCGATGTACCAATATTTGCCAGTGTCCTCAACTTCCTTTCCCGAGCC
TCGCGACTGTCGCTGGACCTGCCCCTACCGTCCCACCTGT
GTATGTTTCCTTTTTCTTTTCTCACTGGTTCTGCATTCTGACGGATTATCAATTCACCCAGCCCGGGATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCCCGCCTGTCAGCTATCGTCGCAATTGCCTTCGCGGTATCCCAATCCGCTAATGCTGCCCTGACCAAGCGCGTTACTTGCGCCTCTGGTCATGTTACAGCCAATGCTGCG
TGCTGCG
CCCTATTCCCAATGGTTGACAAGCTTCAAACGGACCTCTTTGACGGCGGTGACTGCGGCGAAGAGGCTCACTCAGCTCTGCGCCTGTCATTCCATGATGCTATTGGCTTCTCG
ATTCATGGTGGAAA
GGGAGGAGGCGCTGACGGTTCTATTCTCATTTTCAACAAGACGGAACTAGCATTCCATGCCAACGGAGGTATCGACGATATCACTGCTCGGCAATTCCCCGTTTTC
CAGGAGCTTAAATTGAGCCCCGGTGACTT
TGTCCATCTTGCCGCAGCTGTGGGCACAGCCAACTGCCCCGGAGCACCTAGGCTCGAATTCATGTTTGGTCGTCCCGCTCCCAAAGCTCCT
GCTCCAGATTTGACGGTGCCTGAGCCGACGGACAGCGTCACCAAGATTCTTGCGAGGTTCGCTGACGCCGGCTTCTCTCCAGAAGAGGCCGTTTCACTTCTCTCGTCCCACACCATTGCC
GCTGCT
GATGTGGTTGACCCAACCATTCCGGGAACTCCTTTCGACTCCACTGTCGGTACTTTCGACACTCAAGTCTTCCTTGAGGTTCTTCTTAAGGGTAATTCCTTCCCCGGAAATGGC
TCTCAATCCGGAGAGGTTCTGTCGCCTTTGGCAGGAGAGATGCGTCTACAAAGCGACTTCGTTATCTCCCAGGATCCAAGGACGGCTTGCTTATGGCAGGCGCGAGTTA
ACAACCAGCAG
CTCATGGTATCCTCATTCAAATCTGCCATGGCGAAGCTCCAAACTCTCGGGCAGAACAGAGCTAGATTGATCGACTGCTCTGAC
GTCGTTCCCGTCCCGAAGCCATTCACAGCTAACATC
AAGTTCCCGGCAACATTCTCGAGGAAGGATGTTCAAATCGCG
TGTCCTCAACTTCCTTTCCCGAGCCTCGCGACTGTCGCTGGACCTGCCCCTACCGTCCCACCTGTCCCGGGATCTTAA

Retrieve as FASTA