Entry information : GmarCIIBC11
Entry ID 11883
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2013-05-23 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC11
Name GmarCIIBC11
Class Other class II peroxidase type C    [Orthogroup: CIIBC002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC11
start..stop
S start..stop
GmarCIIBC03 537 0 4..358 3..358
GmarCIIBC16 497 2e-178 4..358 3..344
GmarCIIBC15 496 7e-178 9..358 6..349
GmarCIIBC08 470 2e-167 30..358 21..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2739080..2739212 133 N° 2 2738903..2739022 120 N° 3 2738838..2738844 7 N° 4 2738718..2738773 56
N° 5 2738637..2738649 13 N° 6 2738500..2738565 66 N° 7 2738319..2738440 122 N° 8 2738166..2738260 95
N° 9 2738075..2738089 15 N° 10 2737984..2738009 26 N° 11 2737898..2737912 15 N° 12 2737790..2737840 51
N° 13 2737650..2737729 80 N° 14 2737545..2737580 36 N° 15 2737378..2737472 95 N° 16 2737237..2737314 78
N° 17 2737108..2737176 69  
complement(join(2737108..2737176,2737237..2737314,2737378..2737472,2737545..2737 580,2737650..2737729,2737790..2737840,2737898..2737912,2737984..2738009,2738075. .2738089,2738166..2738260,2738319..2738440,2738500..2738565,2738637..2738649,273 8718..2738773,2738838..2738844,2738903..2739022,2739080..2739212))


exon

Literature and cross-references GmarCIIBC11
DNA ref. JGI genome:   scaffold_3 (2739212..2737108)
Cluster/Prediction ref. JGI gene:   134763
Protein sequence: GmarCIIBC11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (335)
PWM (Da):   %s   37590.74 (35007.4)  
PI (pH):   %s   6.23 (5.83) Peptide Signal:   %s   cut: 24 range:24-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFFKGFALFLSLALSQLHFGSAATTQKKVVCPTGHTTANKACCALFPVVDLLQAELFEHGKCDEEAHAALRLAFHDAIGFSTSGGKGGGADGSILAFHSTETAYAANAGIDDIVNHQMPVFLQSRLSPGDFVHLAAAVGTSNCPGTPQLPFFFGRPPPAKAAPDGTVPEPTDSVTTILARFADAGFVAPEVIWLLASHSIAAASKLDPSRPGSPFDSTPGTFDTQFYLEVLLKGNKFPGSGQRSGEVAAPLAGEMRLQSDFAFSQDSRTACFWQEAINNQTFIMGKFETAMAKLQVLGQSSFGLTDCSDVIPTPKTFSSPIRYPASFDRTKVQTACATSAFPSLATVPGAAPTVPPV*

Retrieve as FASTA  
Remarks complete sequence from genomics (15 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTCAAAGGCTTCGCGCTCTTCCTCTCACTCGCTCTTTCTCAACTTCACTTTGGAAGCGCCGCCACCACCCAGAAGAAAGTAGTTTGTCCTACTGGGCACACGACCGCCAAT
AAGGCGTGCTGTG
GTGCGTTCCTTCTCGGCGAAGGGTCTAATGTAGTCTGAAATTGTTGTTGTGCTTTAGCTTTGTTCCCAGTTGTCGATCTCCTCCAGGCAGAACTCTTCGAGCATGGA
AAATGCGATGAAGAGGCCCACGCGGCGCTTCGTTTAGCTTTCCACGACGCCATTGGATTCTCAACGAGCG
GTATGTCATCCTATGCCATTGGTTACGGATTCACCTTGAGCTTTTTCAAC
CCTATTAGGAGGAAAGTACGTCCCTCCACATTTCTTATTTCAAGAACCACCGCCGGCTAATAACTCGGCTGCATAATAGGGGCGGAGGCGCCGACGGATCAATTCTTGCCTTCCATTCAA
CCGAAACTGCATACG
GTACGTATCCTCTTAACTGATTGTCAAGACACTGCCAACTAACCACCTCACCGCCTTGCATTCCAAAGCCGCCAACGCTGGGTAAATATCCCCACCACCCCTTCT
CACTGGAGTATCATTAAACCATGTCATTTTTCTCTTTCTCTAACCAGCATCGACGATATCGTCAACCACCAAATGCCTGTATTCCTCCAAAGCAGGCTATCCCCAGGAGACTTGTGCGTA
ATTTCTTACGTTTCTTTTCTTTATGCAAGCCTATATTGAATTTCATCCTTAGCGTACACCTGGCCGCCGCCGTCGGCACCTCCAATTGCCCCGGCACACCTCAACTCCCGTTCTTCTTCG
GACGGCCACCGCCAGCTAAAGCTGCGCCTGATGGGACCGTGCCAGAACCGACTG
GTGAGTTTTGACGTGGATCTCAGTACTTGTATGAAATGATTTGCTAAAATTTGAATAGACAGTGTC
ACCACTATCCTTGCCCGCTTCGCAGACGCTGGGTTCGTAGCACCAGAAGTGATTTGGTTATTGGCTTCGCATTCGATTGCTGCTGCT
GTACGTGTCCTCGCTCTGGAGTGCTTTCTTCTG
TATGAAAGGATTTGAGATTCTAATTGCTTCATCGCCGTTACAGAGCAAACTCGACCCGGTACGTATCCATCCTTGCCATTCAGATATGTCCCTTTTATTAATATTGGCACTGGAACTTAT
CAGTCAAGGCCAGGATCACCGTTCGATTCGTACGTGGACCTTCACCCTCTCTCTGTTTCGATTAAACTGAGCCGCTTTCTAAACATATTTTATCATGCAGGACGCCTGGTACTTTGTGAG
TTCATCTCCCTCATGTTTGTGCACAGCGTCATACTTACGAAACTTCTATCAGCGACACCCAATTCTACCTAGAAGTGCTGTTGAAGGGAAATAAATTCCCTGGGTAAATTAGCCCTATTT
CCTCGCCCCGATGAATTGAAACTAAATGTTATTGACTACTTAGAAGCGGCCAACGTTCAGGCGAAGTCGCAGCCCCTTTAGCAGGAGAGATGCGGCTCCAAAGCGACTTTGCGTTCTCAC
AAG
GTCTGTATTAAATTTGATTCGCCTTCAAGTTCTTCCCCTCCGTGATGGCTGATTTAATCGCGAGTACAGATTCTCGGACTGCGTGTTTCTGGCAGGAAGCGATAAGTGCGTGGTCCT
CCTTTCCAAATTACTTCCCTTTGGAATGTCAGACTGAGAAATTATTGAATGGACGAATAGATAACCAGACTTTTATCATGGGGAAATTCGAAACTGCCATGGCGAAATTGCAGGTTCTGG
GGCAGAGTAGCTTCGGCTTGACAGACTGCTCCGAC
GTTCGTATAGTCCTATCCTCCAGGCACACACGGTACTTACAAATTAAATTCTAATATCTCCAGGTCATCCCTACTCCAAAGACGT
TCTCGAGCCCCATCCGCTACCCAGCGAGCTTCGACAGGACAAAAGTCCAAACTGCT
GTGAGTACTTTTCTTCCAAAAAAAAACTCTGCGGATAGAAATTTAAATATCATTTAAAAGTGCG
CGACATCGGCGTTCCCGAGCCTGGCGACTGTGCCGGGTGCGGCGCCTACGGTGCCTCCCGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTCAAAGGCTTCGCGCTCTTCCTCTCACTCGCTCTTTCTCAACTTCACTTTGGAAGCGCCGCCACCACCCAGAAGAAAGTAGTTTGTCCTACTGGGCACACGACCGCCAAT
AAGGCGTGCTGTG
CTTTGTTCCCAGTTGTCGATCTCCTCCAGGCAGAACTCTTCGAGCATGGAAAATGCGATGAAGAGGCCCACGCGGCGCTTCGTTTAGCTTTCCACGACGCCATTGGA
TTCTCAACGAGCG
GAGGAAAGGGCGGAGGCGCCGACGGATCAATTCTTGCCTTCCATTCAACCGAAACTGCATACGCCGCCAACGCTGGCATCGACGATATCGTCAACCACCAAATGCCT
GTATTCCTCCAAAGCAGGCTATCCCCAGGAGACTT
CGTACACCTGGCCGCCGCCGTCGGCACCTCCAATTGCCCCGGCACACCTCAACTCCCGTTCTTCTTCGGACGGCCACCGCCAGCT
AAAGCTGCGCCTGATGGGACCGTGCCAGAACCGACTG
ACAGTGTCACCACTATCCTTGCCCGCTTCGCAGACGCTGGGTTCGTAGCACCAGAAGTGATTTGGTTATTGGCTTCGCATTCG
ATTGCTGCTGCT
AGCAAACTCGACCCGTCAAGGCCAGGATCACCGTTCGATTCGACGCCTGGTACTTTCGACACCCAATTCTACCTAGAAGTGCTGTTGAAGGGAAATAAATTCCCTGGA
AGCGGCCAACGTTCAGGCGAAGTCGCAGCCCCTTTAGCAGGAGAGATGCGGCTCCAAAGCGACTTTGCGTTCTCACAAG
ATTCTCGGACTGCGTGTTTCTGGCAGGAAGCGATAAATAAC
CAGACTTTTATCATGGGGAAATTCGAAACTGCCATGGCGAAATTGCAGGTTCTGGGGCAGAGTAGCTTCGGCTTGACAGACTGCTCCGAC
GTCATCCCTACTCCAAAGACGTTCTCGAGC
CCCATCCGCTACCCAGCGAGCTTCGACAGGACAAAAGTCCAAACTGCT
TGCGCGACATCGGCGTTCCCGAGCCTGGCGACTGTGCCGGGTGCGGCGCCTACGGTGCCTCCCGTGTGA

Retrieve as FASTA