Entry information : GmarCIIBC12
Entry ID 11884
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2013-05-23 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC12
Name GmarCIIBC12
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC12
start..stop
S start..stop
GmarCIIBC14 631 0 1..354 1..354
GmarCIIBC 602 0 1..354 1..354
GmarCIIBC06 602 0 1..354 1..354
GmarCIIBC10 601 0 1..354 1..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 736203..736329 127 N° 2 736383..736502 120 N° 3 736560..736566 7 N° 4 736619..736674 56
N° 5 736730..736742 13 N° 6 736797..736862 66 N° 7 736920..737136 217 N° 8 737190..737230 41
N° 9 737284..737298 15 N° 10 737350..737516 167 N° 11 737570..737658 89 N° 12 737718..737795 78
N° 13 737854..737922 69 N° 14 737981..738010 30  
join(736203..736329,736383..736502,736560..736566,736619..736674,736730..736742, 736797..736862,736920..737136,737190..737230,737284..737298,737350..737516,73757 0..737658,737718..737795,737854..737922,737981..738010)


exon

Literature and cross-references GmarCIIBC12
DNA ref. JGI genome:   scaffold_9 (736203..738010)
Cluster/Prediction ref. JGI gene:   138251
Protein sequence: GmarCIIBC12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (342)
PWM (Da):   %s   38092.33 (35848.1)  
PI (pH):   %s   5.14 (5.13) Peptide Signal:   %s   cut: 23 range:23-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSALVAIALAASQTASAALTKRVTCSTGHVTANAACCALFPIVDQIQKDLFDGGECGEEAHSALRLVFHDAIGFSIHGGKGGGADGSILAFNKTETAFHANGGIDDITDRQFPVFLETGLTAGDFVHLAGAIGTANCPGAPRLEFKFGRPAPKAPAPDLTIPEPTDSVTKILARFADAGFSPSEAVALLASHTIAAADVIDTTIPGTPFDSTVGTFDSQVFLEVLLKGSLFPGNGAQTGEVLSPLHGEMRLQSDFAISQDPRTACFWQAMINNQQLMMAEFKAAMAKLQVLGQRNLIDCSDVVPVPKPFTSAIKFPATFSKKDVQIACPQLPFPNLATVAGPAPTVPPVSPRLLEWGDE*

Retrieve as FASTA  
Remarks complete sequence from genomics (13 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTGCTCGTCTCTCAGCTCTTGTCGCCATTGCTCTCGCAGCATCCCAGACTGCTAGCGCCGCTCTTACCAAGCGCGTTACTTGTTCCACTGGCCATGTTACAGCGAACGCTGCT
TGCTGTG
GTACGTGTATCTTAGGATCATGACATTTGTTCTGCCTGACACGAATGTTTTAGCCCTTTTCCCCATTGTCGACCAGATCCAGAAGGATCTCTTCGACGGCGGAGAGTGTGGCG
AGGAGGCTCACTCCGCGCTTCGTCTAGTGTTCCATGACGCCATTGGCTTCTCAATTCACG
GTTAGTGGCTCTCGTTTTCTCGTCCTACCCCATTCCTTACTTTACCTCGAATTCTAGGCG
GAAA
GTTCGTCGTCCTCTCAGAAATCTGCACAAAACCTATTCTAACATCTTAACAGGGGTGGAGGTGCTGACGGTTCTATCTTGGCCTTCAACAAAACCGAGACTGCCTTCCGTAAGTGT
TCTGACGGCAATGTTATGAATTTCTGCTGAAATAGCTGCTTTCCCAGACGCCAACGGAGGGTAAATTCTTTCCTTTCTACATCGGGGCCACATTTTCTAACAAACATCCTGCAGTATCGA
TGACATCACTGACCGTCAATTCCCTGTCTTCTTGGAGACTGGATTGACAGCTGGCGACTT
GTAAGTTTTGTCTGCGCTTCCAGAAATATTTTTTGCTCATTTATTTTTCGCATTAAGCGT
CCACCTTGCCGGAGCTATCGGTACCGCCAACTGTCCCGGAGCGCCACGACTCGAATTCAAGTTTGGTCGCCCAGCCCCGAAGGCGCCTGCTCCCGATCTCACCATCCCTGAGCCCACCGA
CAGCGTTACCAAGATCTTGGCCCGCTTCGCCGATGCCGGTTTCTCTCCTTCAGAGGCGGTCGCCCTCCTTGCGTCCCACACCATCGCTGCCGCC
GTGAGTTGAAAGAATTTGCTCTTGCC
TGCATAATTATTGACAATGGATTCAAGGATGTTATCGACACAACCATCCCTGGAACTCCCTTCGACTCGTAAGTCCCTCAACTTGATTATTGTAGTTCCTACATCTAACTTAATGGTTTA
GCACCGTTGGCACTTTGTAAGCAAAATGAAATAATCAAGTGTGGTATATCTCTAACATTCCTAACAGCGACAGCCAAGTCTTCCTCGAAGTGCTCCTAAAGGGTAGTTTGTTCCCCGGTA
ATGGCGCGCAAACCGGCGAAGTCTTGTCGCCACTCCATGGAGAGATGCGTCTCCAGAGTGACTTTGCCATCTCCCAAGATCCAAGGACAGCCTGCTTCTGGCAAGCGATGATCA
GTGGGT
CTAGACACACGATTTCTAGTACTGGCGCTAATTATCATGATGAACAGACAACCAGCAGCTCATGATGGCCGAATTCAAGGCTGCCATGGCTAAGCTCCAAGTCCTCGGCCAGAGGAACCT
CATCGACTGCTCTGAT
GTAGGTGTTCTGACGGACAGACATGATTTATTTCTTGGTCTGATGATATTGTTCTCTAGGTCGTCCCCGTTCCCAAGCCATTCACCAGCGCCATCAAGTTCCCC
GCCACCTTCTCCAAGAAGGATGTCCAGATTGCC
GTGGGTACACTTTTAATATATTGGTCCTTTCAGTGACTTATAGTTTCCCCTGTTGCAGTGCCCTCAACTGCCCTTCCCCAACCTCGC
CACCGTCGCTGGTCCCGCTCCAACCGTTCCCCCCGTGTCA
GTATATTTCTTCGCTTATCATTTGTCATCAATATCTGACTGTCCTATTCTACATCCAGCCCCGGCTCTTAGAATGGGGTG
ACGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTGCTCGTCTCTCAGCTCTTGTCGCCATTGCTCTCGCAGCATCCCAGACTGCTAGCGCCGCTCTTACCAAGCGCGTTACTTGTTCCACTGGCCATGTTACAGCGAACGCTGCT
TGCTGTG
CCCTTTTCCCCATTGTCGACCAGATCCAGAAGGATCTCTTCGACGGCGGAGAGTGTGGCGAGGAGGCTCACTCCGCGCTTCGTCTAGTGTTCCATGACGCCATTGGCTTCTCA
ATTCACG
GCGGAAAGGGTGGAGGTGCTGACGGTTCTATCTTGGCCTTCAACAAAACCGAGACTGCCTTCCACGCCAACGGAGGTATCGATGACATCACTGACCGTCAATTCCCTGTCTTC
TTGGAGACTGGATTGACAGCTGGCGACTT
CGTCCACCTTGCCGGAGCTATCGGTACCGCCAACTGTCCCGGAGCGCCACGACTCGAATTCAAGTTTGGTCGCCCAGCCCCGAAGGCGCCT
GCTCCCGATCTCACCATCCCTGAGCCCACCGACAGCGTTACCAAGATCTTGGCCCGCTTCGCCGATGCCGGTTTCTCTCCTTCAGAGGCGGTCGCCCTCCTTGCGTCCCACACCATCGCT
GCCGCC
GATGTTATCGACACAACCATCCCTGGAACTCCCTTCGACTCCACCGTTGGCACTTTCGACAGCCAAGTCTTCCTCGAAGTGCTCCTAAAGGGTAGTTTGTTCCCCGGTAATGGC
GCGCAAACCGGCGAAGTCTTGTCGCCACTCCATGGAGAGATGCGTCTCCAGAGTGACTTTGCCATCTCCCAAGATCCAAGGACAGCCTGCTTCTGGCAAGCGATGATCA
ACAACCAGCAG
CTCATGATGGCCGAATTCAAGGCTGCCATGGCTAAGCTCCAAGTCCTCGGCCAGAGGAACCTCATCGACTGCTCTGAT
GTCGTCCCCGTTCCCAAGCCATTCACCAGCGCCATCAAGTTC
CCCGCCACCTTCTCCAAGAAGGATGTCCAGATTGCC
TGCCCTCAACTGCCCTTCCCCAACCTCGCCACCGTCGCTGGTCCCGCTCCAACCGTTCCCCCCGTGTCACCCCGGCTCTTAGAA
TGGGGTGACGAGTGA

Retrieve as FASTA