Entry information : GmarCIIBC13
Entry ID 11885
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2013-05-23 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC13
Name GmarCIIBC13
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC13
start..stop
S start..stop
GmarCIIBC06 564 0 1..355 1..354
GmarCIIBC14 537 0 1..358 1..357
GmarCIIBC09 529 0 1..358 1..359
HsubCIIBC02 521 0 1..358 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1279059..1279185 127 N° 2 1279243..1279307 65 N° 3 1279357..1279411 55 N° 4 1279465..1279471 7
N° 5 1279524..1279579 56 N° 6 1279632..1279644 13 N° 7 1279699..1279764 66 N° 8 1279824..1279945 122
N° 9 1280000..1280098 99 N° 10 1280157..1280164 8 N° 11 1280221..1280246 26 N° 12 1280302..1280316 15
N° 13 1280368..1280418 51 N° 14 1280475..1280554 80 N° 15 1280605..1280640 36 N° 16 1280697..1280791 95
N° 17 1280852..1280929 78 N° 18 1280984..1281048 65 N° 19 1281098..1281110 13  
join(1279059..1279185,1279243..1279307,1279357..1279411,1279465..1279471,1279524 ..1279579,1279632..1279644,1279699..1279764,1279824..1279945,1280000..1280098,12 80157..1280164,1280221..1280246,1280302..1280316,1280368..1280418,1280475..12805 54,1280605..1280640,1280697..1280791,1280852..1280929,1280984..1281048,1281098.. 1281110)


exon

Literature and cross-references GmarCIIBC13
DNA ref. JGI genome:   scaffold_10 (1279059..1281110)
Cluster/Prediction ref. JGI gene:   155556
Protein sequence: GmarCIIBC13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (336)
PWM (Da):   %s   37337.82 (35098.6)  
PI (pH):   %s   4.96 (4.84) Peptide Signal:   %s   cut: 23 range:23-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVRSLSAIIALALATSQVANAALTKRFTCATGQVTAHSACCALFPIVEKLQTELFDGGECGEEAHSALRLAFHDAIGFSVNGGKGGGADGSILAFNSTETLFHANGGTDDIVASQWPVFKETKLSAGDFVHLAAAVGITNCAGSPRLNFFLGRSPPRAAAPDLTVPEPTDSVTSILARFDDAGFSPAEVVALLASHTIAAAAIDPSIPGTPFDSTVETFDSQVFLEVLLKGKLFPGNGPQSGEVLSPIAGEMRLQSDFAISQDHRTACLWQNMINNQHLMVTNFKNAMTKLQLLGHNEDFLTDCSDVIPTPAPFAGPIKFPASFSKKDVQIACVQSAFPSLATVAGPAPTIPPVPPS*

Retrieve as FASTA  
Remarks complete sequence from genomics (18 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTCCGAAGTCTTTCTGCGATCATTGCTTTAGCCCTGGCCACATCTCAGGTCGCCAACGCAGCCCTCACCAAGCGATTCACCTGTGCTACCGGACAGGTTACTGCTCATTCTGCT
TGTTGTG
GTAAACTCTCTCTATTTATGACCATAATTCGATATTTTCTAATTTAATGTAACGCAGCACTCTTCCCAATCGTAGAAAAACTACAGACGGAGCTCTTTGACGGAGGAGAGTGC
GGTGAAGAG
GTTCGTATTTATTTCATAGACGTCTCTCATTTTCTGATCTTGTATTCAGGCACATTCCGCCCTTCGTTTGGCTTTCCACGATGCCATTGGTTTCTCCGTTAATGGTCAGTT
AAATCCCTTCAATGTCGTTTGGCTATGCACTGACCAATATCTAAAGGTGGAAAGTACGTCTCTTTAACTAAAGATGACAGGGATAAGAAACCAATTATCTTCTAGAGGAGGAGGTGCCGA
TGGTTCCATCCTCGCCTTCAACTCCACGGAGACTTTATTCC
GTATGTACTCTGACAGATAGTGTCGACTTCTTGCTGATTTTCTTTGTTCCAGACGCAAATGGAGGGTAAGTTCTTGCAA
TAATTTTTCTCACATCGTTAATTTAATGTGTTACACGTAGAACCGACGACATTGTCGCGAGTCAATGGCCCGTCTTCAAGGAGACAAAGTTAAGCGCTGGTGATTTGTATGTGCCTTCAT
CTGCAGTGACGCGGAATTCCTACTTATAAACCTACTTCTAAACAGTGTCCATCTTGCCGCAGCTGTGGGCATCACCAACTGCGCTGGCTCACCAAGGCTTAACTTTTTCCTCGGTCGTTC
CCCTCCTCGGGCCGCCGCACCTGATTTAACTGTTCCCGAGCCCACTG
GTATGACTTTCTGAACATAATCCCCTTTCTCAGAGGACTTACAAATTTAAATAGACAGTGTCACCTCTATCTT
AGCTCGATTCGATGACGCTGGATTCAGTCCGGCTGAGGTTGTTGCTCTCCTAGCATCTCATACCATCGCTGCAGCGGCAA
GTAAATGTTCTCATATTTCTAACGTTATGCTCATCTTCGA
AACGCTCTTAGGATGTAGTTGACCCGGTAAGCAACGTGTGTCGCAAGGCGAGATATTTCGGTCCCTGACCCGCTCTTCGAAGTCTATTCCTGGAACTCCGTTCGACTCGTGAGTACTCTA
ATTAGCTATGAGGGTTTCTCGCCATTCTTACATCTGCTTATAGAACGGTAGAAACTTTGTGAGAATTACCCGCTTCTTGCCTTACGTAATATTCTCATCATCGTTCCAGCGACTCGCAAG
TCTTCCTCGAAGTCTTGTTAAAGGGAAAACTATTCCCAGG
GTGAGTTCATGTCTTTACTCCGTGACCTGCCCACTTCATAGCCGAAATTATAACAGAAACGGACCCCAGTCCGGTGAAGT
TCTGTCGCCAATTGCAGGTGAAATGCGCCTGCAGAGCGATTTTGCTATATCCCAAG
GTTCCTCTCATTTTTTAACACGTCGTCCACATATCTCATTGGCTTATTAGATCACCGAACTGCT
TGTCTGTGGCAAAACATGATCA
GTGAGTGACCAGCGGGAGCATTTGCGCCATTAGCTTTATCTTACCTACGACACTAGACAACCAACACCTGATGGTCACCAACTTCAAGAACGCCATGA
CCAAATTGCAGCTTCTTGGGCATAATGAAGACTTCCTTACGGACTGCTCTGAT
GTACGTACCCAAATGGATATGTTTTAATCTCGAATGCTCACGTGCACATTACACCCTTAGGTTATCC
CTACCCCAGCGCCTTTCGCCGGACCTATCAAGTTCCCGGCCTCATTTTCAAAGAAAGATGTTCAAATTGCG
GTGAGTAAAATATGCCTTACAATAAGCCTTTATTTGACTTGGGTGTCCG
TTCAGTGCGTTCAATCCGCATTCCCAAGCCTGGCTACTGTCGCAGGACCTGCACCAACCATACCTCCTGTGTAAGCATTGTATGCCTGGTCTTTCGGTCGGTACTGACGAGTCCCATAGC
CCTCCATCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTCCGAAGTCTTTCTGCGATCATTGCTTTAGCCCTGGCCACATCTCAGGTCGCCAACGCAGCCCTCACCAAGCGATTCACCTGTGCTACCGGACAGGTTACTGCTCATTCTGCT
TGTTGTG
CACTCTTCCCAATCGTAGAAAAACTACAGACGGAGCTCTTTGACGGAGGAGAGTGCGGTGAAGAGGCACATTCCGCCCTTCGTTTGGCTTTCCACGATGCCATTGGTTTCTCC
GTTAATG
GTGGAAAAGGAGGAGGTGCCGATGGTTCCATCCTCGCCTTCAACTCCACGGAGACTTTATTCCACGCAAATGGAGGAACCGACGACATTGTCGCGAGTCAATGGCCCGTCTTC
AAGGAGACAAAGTTAAGCGCTGGTGATTT
TGTCCATCTTGCCGCAGCTGTGGGCATCACCAACTGCGCTGGCTCACCAAGGCTTAACTTTTTCCTCGGTCGTTCCCCTCCTCGGGCCGCC
GCACCTGATTTAACTGTTCCCGAGCCCACTG
ACAGTGTCACCTCTATCTTAGCTCGATTCGATGACGCTGGATTCAGTCCGGCTGAGGTTGTTGCTCTCCTAGCATCTCATACCATCGCT
GCAGCGGCAA
TTGACCCGTCTATTCCTGGAACTCCGTTCGACTCAACGGTAGAAACTTTCGACTCGCAAGTCTTCCTCGAAGTCTTGTTAAAGGGAAAACTATTCCCAGGAAACGGACCC
CAGTCCGGTGAAGTTCTGTCGCCAATTGCAGGTGAAATGCGCCTGCAGAGCGATTTTGCTATATCCCAAG
ATCACCGAACTGCTTGTCTGTGGCAAAACATGATCAACAACCAACACCTG
ATGGTCACCAACTTCAAGAACGCCATGACCAAATTGCAGCTTCTTGGGCATAATGAAGACTTCCTTACGGACTGCTCTGAT
GTTATCCCTACCCCAGCGCCTTTCGCCGGACCTATCAAG
TTCCCGGCCTCATTTTCAAAGAAAGATGTTCAAATTGCG
TGCGTTCAATCCGCATTCCCAAGCCTGGCTACTGTCGCAGGACCTGCACCAACCATACCTCCTGTCCCTCCATCCTAG

Retrieve as FASTA