Entry information : GmarCIIBC14
Entry ID 11886
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2013-05-23 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC14
Name GmarCIIBC14
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC14
start..stop
S start..stop
GmarCIIBC12 630 0 1..354 1..354
GmarCIIBC10 612 0 1..357 1..359
GmarCIIBC 590 0 1..354 1..354
GmarCIIBC09 588 0 1..357 1..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55045..55171 127 N° 2 54872..54991 120 N° 3 54807..54813 7 N° 4 54699..54754 56
N° 5 54628..54640 13 N° 6 54510..54575 66 N° 7 54241..54457 217 N° 8 54143..54183 41
N° 9 54068..54082 15 N° 10 53846..54012 167 N° 11 53703..53791 89 N° 12 53564..53641 78
N° 13 53438..53502 65 N° 14 53365..53377 13  
complement(join(53365..53377,53438..53502,53564..53641,53703..53791,53846..54012 ,54068..54082,54143..54183,54241..54457,54510..54575,54628..54640,54699..54754,5 4807..54813,54872..54991,55045..55171))


exon

Literature and cross-references GmarCIIBC14
DNA ref. JGI genome:   scaffold_65 (55171..53365)
Cluster/Prediction ref. JGI gene:   162345
Protein sequence: GmarCIIBC14
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (335)
PWM (Da):   %s   37487.02 (35183.8)  
PI (pH):   %s   5.59 (5.32) Peptide Signal:   %s   cut: 23 range:23-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSTIVSIALVASQTANAALTKRVTCASGHVTANAACCALFPIVDQIQKDLFDGGECGEEAHSALRLVFHDAIGFSIYGGKGGGADGSILAFNETETAFHANGGIDDIVARQFPVFLETKLSAGDFVHLAGAIGTANCAGAPRLQFKFGRPPPKAAAPDLTIPEPTDSVTKILARFADAGFSPQEAVALLASHTIAAADEVDTTIPGTPFDSTVSTFDTQVFLEVLLKGNLFPGNGSQVGEVLSPLHGEMRLQSDFAISQDRRTACFWQQMINNQNFMMSQFKAAMAKLQVLGQRNLIDCSDVVPIPKPFTSAIKFPASFSKKDVQIACPQLAFPSLATVAGPAPTIPPVPGS*

Retrieve as FASTA  
Remarks complete sequence from genomics (13 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTCGGCTTTCGACTATTGTCTCTATTGCTCTCGTAGCATCACAGACCGCCAACGCCGCTCTTACCAAGCGCGTTACTTGCGCATCGGGCCATGTCACCGCGAATGCTGCC
TGCTGCG
GTACGCATACTAAAATTTTCATGACGTTCCTCCTCTTATCCCAACGAGTGTAGCCCTTTTCCCCATCGTCGATCAAATCCAGAAGGATCTCTTCGACGGTGGCGAGTGTGGTG
AGGAGGCTCACTCTGCGCTCCGCCTCGTGTTCCATGATGCTATTGGGTTCTCCATTTACG
GTGAGTGCACCTTTTCTTTCTTCCTCGGATTCAATAACTTACTCTGTCCTGAAATTAGGC
GGGAA
GTTCGTCGTCGTTTTGAAAAATTTAACCGGAAATCTACTAACTATTTTATAGAGGCGGCGGTGCCGATGGCTCCATCTTGGCCTTCAACGAGACAGAGACCGCTTTCCGTAAGTA
CACACAAAAGATCGAAATACGAAACCTTCCTGAATCGTTGATTTTCTCCAGACGCTAATGGAGGGTGAATAATAGTCTCCCTACCAAGTATACAAATATCTAATAGTCATGTCCAGCATC
GACGATATCGTCGCTCGCCAGTTCCCTGTCTTCTTGGAGACGAAATTAAGCGCCGGTGACTT
GTAAGCGTGCCTAAAACTCTCTGAACAATTCGTTCTTACCTCTTATACAAAGCGTCCA
TCTCGCCGGTGCTATCGGCACAGCCAATTGCGCAGGTGCCCCCCGACTTCAATTCAAGTTCGGTCGCCCGCCACCAAAAGCCGCTGCTCCCGATCTTACCATCCCAGAGCCGACCGATAG
TGTCACCAAGATCTTGGCCCGCTTCGCCGATGCCGGGTTTTCTCCGCAGGAGGCTGTTGCCCTCCTTGCGTCTCACACCATCGCTGCAGCC
GTGAGTTCGAATAAAAGCTTCTTTGGTTA
ATGGTTTATTGACAGTAAAATAATCCAGGATGAGGTCGACACGACTATCCCTGGGACTCCGTTCGATTCGTAAGTCTCGAATATATACAATTGTAGTATCAAATCTCTGATATGGTTTTC
AAATTCCAGCACTGTCAGCACTTTGTAGACAAAAAAAACACTTTATATCAGTGACATACGCCTGACACATCTTAAATAGTGACACCCAAGTCTTCCTTGAGGTTCTCCTCAAAGGTAACC
TGTTCCCAGGGAACGGCTCTCAAGTCGGCGAAGTCCTTTCCCCACTCCACGGAGAGATGCGTCTCCAAAGCGATTTCGCTATTTCTCAGGACAGGAGAACCGCCTGCTTCTGGCAGCAAA
TGATCA
GTGAGTCGGGTCTATGTTTCCAAGTGCAAACGCTGAGGGAGGGACGATGAACAGACAATCAGAACTTTATGATGTCCCAATTCAAGGCTGCCATGGCTAAACTGCAGGTCCTCG
GCCAGAGGAACCTTATTGACTGCTCGGAT
GTGCGTATATTTATTAGCAGACGCTGTTTATTGCTGACCCCGTAGTATTATTACTCTGCAGGTCGTTCCCATTCCAAAGCCATTTACTAGC
GCCATCAAATTCCCAGCCAGCTTCTCGAAGAAAGACGTCCAGATTGCC
GTGAGCTCCTCTCTAAAATTTTGCCTTTTTTCGCGATTCAATTCCTCTCTCTTATGATCAGTGTCCACAACT
GGCCTTTCCCAGCCTCGCTACCGTCGCTGGTCCAGCCCCAACTATACCCCCCGT
GTCAGTCCATTCCTAATTTTCTGATCTCACCGACCTCTGACGACTGTTTTATTCCGACAGCCCCGG
CTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTCGGCTTTCGACTATTGTCTCTATTGCTCTCGTAGCATCACAGACCGCCAACGCCGCTCTTACCAAGCGCGTTACTTGCGCATCGGGCCATGTCACCGCGAATGCTGCC
TGCTGCG
CCCTTTTCCCCATCGTCGATCAAATCCAGAAGGATCTCTTCGACGGTGGCGAGTGTGGTGAGGAGGCTCACTCTGCGCTCCGCCTCGTGTTCCATGATGCTATTGGGTTCTCC
ATTTACG
GCGGGAAAGGCGGCGGTGCCGATGGCTCCATCTTGGCCTTCAACGAGACAGAGACCGCTTTCCACGCTAATGGAGGCATCGACGATATCGTCGCTCGCCAGTTCCCTGTCTTC
TTGGAGACGAAATTAAGCGCCGGTGACTT
CGTCCATCTCGCCGGTGCTATCGGCACAGCCAATTGCGCAGGTGCCCCCCGACTTCAATTCAAGTTCGGTCGCCCGCCACCAAAAGCCGCT
GCTCCCGATCTTACCATCCCAGAGCCGACCGATAGTGTCACCAAGATCTTGGCCCGCTTCGCCGATGCCGGGTTTTCTCCGCAGGAGGCTGTTGCCCTCCTTGCGTCTCACACCATCGCT
GCAGCC
GATGAGGTCGACACGACTATCCCTGGGACTCCGTTCGATTCCACTGTCAGCACTTTTGACACCCAAGTCTTCCTTGAGGTTCTCCTCAAAGGTAACCTGTTCCCAGGGAACGGC
TCTCAAGTCGGCGAAGTCCTTTCCCCACTCCACGGAGAGATGCGTCTCCAAAGCGATTTCGCTATTTCTCAGGACAGGAGAACCGCCTGCTTCTGGCAGCAAATGATCA
ACAATCAGAAC
TTTATGATGTCCCAATTCAAGGCTGCCATGGCTAAACTGCAGGTCCTCGGCCAGAGGAACCTTATTGACTGCTCGGAT
GTCGTTCCCATTCCAAAGCCATTTACTAGCGCCATCAAATTC
CCAGCCAGCTTCTCGAAGAAAGACGTCCAGATTGCC
TGTCCACAACTGGCCTTTCCCAGCCTCGCTACCGTCGCTGGTCCAGCCCCAACTATACCCCCCGTCCCCGGCTCTTAG

Retrieve as FASTA