Entry information : GmarCIIBC15
Entry ID 11888
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2015-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC15
Name GmarCIIBC15
Class Other class II peroxidase type C    [Orthogroup: CIIBC002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC15
start..stop
S start..stop
GmarCIIBC16 519 0 1..349 1..344
GmarCIIBC03 511 0 1..349 1..358
GmarCIIBC08 491 8e-176 1..349 1..348
GmarCIIBC11 478 8e-171 10..349 13..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1363187..1363313 127 N° 2 1363063..1363127 65 N° 3 1362902..1363008 107 N° 4 1362596..1362661 66
N° 5 1362420..1362541 122 N° 6 1362274..1362368 95 N° 7 1362195..1362209 15 N° 8 1362113..1362138 26
N° 9 1362040..1362054 15 N° 10 1361936..1361986 51 N° 11 1361802..1361881 80 N° 12 1361711..1361746 36
N° 13 1361562..1361650 89 N° 14 1361439..1361504 66 N° 15 1361082..1361150 69  
complement(join(1361082..1361150,1361439..1361504,1361562..1361650,1361711..1361 746,1361802..1361881,1361936..1361986,1362040..1362054,1362113..1362138,1362195. .1362209,1362274..1362368,1362420..1362541,1362596..1362661,1362902..1363008,136 3063..1363127,1363187..1363313))


exon

Literature and cross-references GmarCIIBC15
DNA ref. JGI genome:   scaffold_7 (1363313..1361082)
Cluster/Prediction ref. JGI gene:   265964
Protein sequence: GmarCIIBC15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (329)
PWM (Da):   %s   36487.86 (34392.7)  
PI (pH):   %s   4.25 (4.20) Peptide Signal:   %s   cut: 21 range:21-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLGRLAVFVALAALQLGNAAIVSKRSVTCPTGQTTANEACCALFPVIDSMQKDLFEGGECGEDAHAALRLAFHDAIGFSTNGRGGGADGSILTFHTTEETYAANAGIDDIVARQMPIFLQSNLTAGDFVHLAAAIGTGNCPGAPQLSYSIGRPAPAGPAPDGTVPEPTQSVSEILGRFSDAGFFSAEVIWLLASHSIAAANKIDTSIPGTPFDSTPSTFDTQFFLEVLLNGMQFPGSGQHTGEVVSPLAGEMRLQSDFAFSQDPQTACFWQEAIDDQTFIMARFRDAMQKLQLLGQSGLTDCSDVIPVPKAFSSHITYPGGFNQTDCTALPFPSIATVSGPAPTIPPV*

Retrieve as FASTA  
Remarks complete sequence from genomics (16 introns). Incorrect prediction from JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTGGGTCGTCTCGCAGTCTTTGTAGCCCTCGCGGCCTTACAGTTAGGCAACGCCGCCATTGTTTCGAAGCGTTCTGTTACCTGCCCAACCGGACAGACGACCGCCAACGAGGCT
TGTTGTG
GTGCGTGTTCTTTTTCTACTTTATGCAACGATGCAGGCGATCTGAGACTAATTTTGCAGCACTGTTCCCTGTCATTGATTCAATGCAGAAAGATCTCTTCGAAGGCGGAGAAT
GCGGCGAAGAT
GTTGGACTTCCATCGTGTGACCGAGTCAATTCTTTTCACTGACCCAAGTCATAGGCCCATGCTGCGCTTCGTCTTGCTTTCCACGATGCAATTGGCTTTTCTACTAATG
GTATGCCACTTGCTCGTCTTTCGGAATCTATGTCTAAAACGCGGCTCTTTAG
GCGGCAAGTCAGTACTGAATTTACATTAATAATGAATTCTCCCAACAGCTTAATTAGAGGCGGAGGCG
CTGATGGTTCAATTCTTACTTTCCATACAACGGAGGAAACCTACGGTATATTTTTTTCCAGTTATACTTTACCGGCCTGCTGACGAGTTCTTCCACTACATAGCTGCAAATGCTGGGTGA
GCATCGCTTTATTCGTCAAGATGTTATATTTTCTAATGTTCACTTTCTTTAGTATCGACGACATCGTCGCAAGGCAAATGCCTATCTTCCTCCAAAGCAACCTAACTGCAGGGGACTTGT
AAGCTCCTCGTCATTGAGACAATGAGATATCCAGGCAAACTTTGCACTACAGTGTTCATCTCGCAGCCGCAATCGGTACTGGTAACTGCCCTGGAGCACCACAGCTTTCCTATTCTATAG
GCCGACCTGCTCCAGCTGGACCTGCTCCTGATGGCACCGTTCCCGAACCAACTC
GTAAGAGACAGTTCCATCCAATGGCTTGTATGCTGACCTCGCTGAATTTAGAAAGCGTCTCAGAAA
TTCTAGGCAGGTTTTCGGACGCTGGTTTCTTCTCGGCAGAGGTGATCTGGCTTCTCGCTTCGCACTCCATTGCCGCCGCG
GTAAGTCGACCATCGTTAACTCTCTAATTGTTGGTTGAGA
TTGCTAATCGTCCCGCTGGCATAGAACAAAATTGATACGGTAATTACTCTCATTAGCATTCTAGCCTCGGTTGACCTAATGGTGCTGGGTAACAGTCGATCCCAGGAACCCCATTCGATT
C
GTGAGCAAACCTGCGCTAGTTAACGAATAGGTTCAACCGTTCTAATTCATGTCATTAGCACTCCCAGTACCTTGTATGTCCAACGTTTCTTCTCTTTCGCGTGTTATACTTATGAACTC
GATTCAGCGACACCCAGTTCTTCCTCGAGGTACTTTTGAATGGAATGCAATTCCCTGGGTAGGTTATTGATTTATCCATCTCATCACAACCTGATTCACCCGTATATTTTAGGAGTGGGC
AGCATACAGGCGAAGTTGTATCCCCACTAGCCGGAGAAATGCGTTTACAAAGTGATTTTGCATTTTCTCAAG
GTTAGATCTAAACTTTGCTTGCACCAATTTTGCAAGTCTGAACGTGAG
CGTGTAGACCCACAGACTGCTTGCTTCTGGCAGGAGGCTATCGGCAAGTTTCTTTTGTACTATTTAATTTAATTCGAATCGCCGGACGAATGATACTTCACAGACGATCAAACTTTCATT
ATGGCCAGGTTCAGGGATGCGATGCAGAAGTTGCAACTCCTGGGCCAGAGCGGGTTAACTGATTGCTCTGAT
GTACGTTACTTTCCCTTGATCGCTGCCTCAAGGGATACCAATCATAGT
TATCGTTAGGTCATTCCGGTGCCGAAAGCATTTTCCAGTCACATTACATATCCAGGGGGCTTCAACCAGACTGACGTTGGGATAGGCCTATCAGGCCTACCCTAGCAGTCCGAGTCTGGC
TAAGCTCGAGAAGCGCGTCGAGCAGTGCGCTATCGCGTCGCACGTAGTGGCAAGAGGCAACCCCGAATGTGTTCGTCACAGGACCGCGCGGCGTCTACATGCAGACAGGCTGTGCTACGA
TCACTATCTAATCTAATCGTGGCTCGGGCAGCTCGGGCCAGAGGCCACTACTACAACGTTCAAATCGCTGTAAATAGCCTCCCCGTCTTCAGTTCATTTTGTGGTTTATTGACACGTTGA
TAGTGTACTGCACTCCCGTTTCCAAGCATCGCAACAGTCTCAGGTCCTGCACCTACGATTCCACCCGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTGGGTCGTCTCGCAGTCTTTGTAGCCCTCGCGGCCTTACAGTTAGGCAACGCCGCCATTGTTTCGAAGCGTTCTGTTACCTGCCCAACCGGACAGACGACCGCCAACGAGGCT
TGTTGTG
CACTGTTCCCTGTCATTGATTCAATGCAGAAAGATCTCTTCGAAGGCGGAGAATGCGGCGAAGATGCCCATGCTGCGCTTCGTCTTGCTTTCCACGATGCAATTGGCTTTTCT
ACTAATGGTATGCCACTTGCTCGTCTTTCGGAATCTATGTCTAAAACGCGGCTCTTTAG
TATCGACGACATCGTCGCAAGGCAAATGCCTATCTTCCTCCAAAGCAACCTAACTGCAGGG
GACTT
TGTTCATCTCGCAGCCGCAATCGGTACTGGTAACTGCCCTGGAGCACCACAGCTTTCCTATTCTATAGGCCGACCTGCTCCAGCTGGACCTGCTCCTGATGGCACCGTTCCCGAA
CCAACTC
AAAGCGTCTCAGAAATTCTAGGCAGGTTTTCGGACGCTGGTTTCTTCTCGGCAGAGGTGATCTGGCTTCTCGCTTCGCACTCCATTGCCGCCGCGAACAAAATTGATACGTCG
ATCCCAGGAACCCCATTCGATTC
CACTCCCAGTACCTTCGACACCCAGTTCTTCCTCGAGGTACTTTTGAATGGAATGCAATTCCCTGGGAGTGGGCAGCATACAGGCGAAGTTGTATCC
CCACTAGCCGGAGAAATGCGTTTACAAAGTGATTTTGCATTTTCTCAAG
ACCCACAGACTGCTTGCTTCTGGCAGGAGGCTATCGACGATCAAACTTTCATTATGGCCAGGTTCAGGGAT
GCGATGCAGAAGTTGCAACTCCTGGGCCAGAGCGGGTTAACTGATTGCTCTGAT
GTCATTCCGGTGCCGAAAGCATTTTCCAGTCACATTACATATCCAGGGGGCTTCAACCAGACTGAC
TGTACTGCACTCCCGTTTCCAAGCATCGCAACAGTCTCAGGTCCTGCACCTACGATTCCACCCGTGTAA

Retrieve as FASTA