Entry information : GmarCIIBC
Entry ID 11890
Creation 2013-05-24 (Nizar Fawal)
Last sequence changes 2016-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC
Name GmarCIIBC
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC
start..stop
S start..stop
GmarCIIBC12 585 0 1..354 1..354
GmarCIIBC09 583 0 1..354 1..356
GmarCIIBC07 581 0 1..354 1..357
ApraCIIBC01 579 0 1..354 1..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66140..66263 124 N° 2 66025..66089 65 N° 3 65912..65970 59 N° 4 65735..65803 69
N° 5 65616..65681 66 N° 6 65341..65557 217 N° 7 65273..65287 15 N° 8 65175..65215 41
N° 9 64961..65127 167 N° 10 64814..64908 95 N° 11 64682..64759 78 N° 12 64554..64622 69
complement(join(64554..64622,64682..64759,64814..64908,64961..65127,65175..65215 ,65273..65287,65341..65557,65616..65681,65735..65803,65912..65970,66025..66089,6 6140..66263))


exon

Literature and cross-references GmarCIIBC
DNA ref. JGI genome:   scaffold_27 (66263..64554)
Cluster/Prediction ref. JGI gene:   271169
Protein sequence: GmarCIIBC
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355
PWM (Da):   %s   37083.88  
PI (pH):   %s   5.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLTSIVWIALAASQLVKGAATAYKCSNGKVTANAACCALFPVVDLLQKDLFDGGECGEEAHSALRLSFHDAIGFSIHGLGGGADGSILAFNKTENAFHANGGIDDITDRQFPVFLESKLTAGDFVHLAAAVGTANCPGAPRLEFKFGRPAPKAPAPDLTVPEPTDSVTKILARFADAGFSPQEAVALLSSHTIAAADVVDPTIPGTPFDSTVGTFDTQVFLEVLLKGHLFPGNGSQAGEVLSPLAGEMRLQSDFAISQDSRTACFWQAMVNDQNRMVTEFKAAMAKLQVLGQNTAKLVDCSDIVPVPKSFTTNIKFPATFSKKDVQIACPKLAFPSLATVAGPAPTIPPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCCCGTCTTACTTCTATTGTCTGGATTGCTCTCGCCGCATCTCAGCTTGTCAAGGGTGCCGCCACAGCGTACAAGTGCTCCAACGGCAAGGTTACAGCCAATGCTGCTTGT
TGCG
GTATGTCAATGTCAAATTTTGAAGCCTTCGTGATATCCATTTTCTTCTAGCCTTGTTCCCAGTCGTAGACCTGTTGCAAAAGGATCTCTTTGATGGCGGAGAATGTGGTGAGGAGG
TAAATATCTAACCTTGGACTATCAGTGTTGGGTCTGATGGACCCTTGCTTCAGGCTCATTCTGCCCTTCGTCTCTCTTTCCACGACGCAATTGGATTCTCGATCCACGGTTTGTTTTATT
TGGGTGTCCAATGACTTATGGGTATTAAAGTAATCTCTCTTTCAGGTGGAAAGTTCGTTAATGATAGGTTCTGTTCGACCACATTCTAATAAATTTACAGGGGAGGGGGTGCTGATGGCT
CTATCCTGGCATTCAACAAAACCGAGAATGCCTTCCACGCCAATGGAGG
GTAAATAGCAATTGTTTTTTTTCCTATTACCCAATCTGAACTACTCTCTCAAGAATCGACGACATCACCGA
CCGTCAATTCCCAGTCTTCCTCGAATCCAAACTCACTGCCGGAGATTT
GTAAGTACTTACTTTGTATTATGACGAGGATTGTTCTTGAATATTCTATTCCAAATAGCGTCCATCTCGCAG
CTGCAGTCGGTACTGCTAACTGCCCTGGCGCTCCAAGACTCGAGTTCAAATTTGGCCGACCCGCGCCAAAGGCACCTGCACCCGATCTTACCGTCCCAGAACCAACAGACAGTGTAACCA
AGATTCTGGCCAGGTTCGCTGACGCTGGGTTTTCTCCTCAAGAGGCGGTCGCACTTCTCTCTTCCCACACCATTGCCGCTGCT
GTACGTTAGAGTCTCTGAAATTCTTATTCGACATGCT
GACGTTTTCCCTACAGGATGTCGTTGATCCGGTGCATATTTTGTCATTCTAATTTGCCATATATCCCTTTTAAACCCTGCTTTTACAGACCATTCCAGGAACTCCTTTCGACTCCACCGT
TGGCACTTT
GTGAGTTGGCAGCATCGCTCCAAGGAAATAAGCTGACAGGTCTTTAGCGATACCCAAGTCTTCCTCGAAGTTCTCCTGAAGGGTCACTTGTTCCCCGGGAACGGATCTCAA
GCCGGAGAGGTCCTTTCTCCTCTCGCAGGAGAAATGCGCCTCCAGAGCGATTTCGCCATCTCCCAGGACTCGAGGACCGCTTGCTTCTGGCAAGCCATGGTTA
GTAAGTAACCTTTTACT
GTACCCAACTTTTTCGAACGCTAACAATGATGTAGATGACCAAAATCGCATGGTAACCGAATTCAAGGCTGCGATGGCTAAGCTCCAGGTCCTCGGACAGAACACCGCTAAGCTAGTCGA
CTGCTCTGAT
GTAAGTTTTTTTATATCCATCATACAACACCTTCGTCCAATATTATCCACCCAGATCGTACCTGTCCCTAAATCCTTCACCACCAACATCAAGTTCCCGGCTACATTCTC
AAAGAAGGATGTCCAAATTGCG
GTCAGTAATTTAATTGACCTCCGCCTGCCTAGGCAGCCCCATCTCATTACTCTTTCTAGTGCCCCAAACTTGCCTTCCCGAGTCTTGCTACTGTTGCC
GGACCTGCTCCCACTATCCCTCCTGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCCCGTCTTACTTCTATTGTCTGGATTGCTCTCGCCGCATCTCAGCTTGTCAAGGGTGCCGCCACAGCGTACAAGTGCTCCAACGGCAAGGTTACAGCCAATGCTGCTTGT
TGCG
CCTTGTTCCCAGTCGTAGACCTGTTGCAAAAGGATCTCTTTGATGGCGGAGAATGTGGTGAGGAGGCTCATTCTGCCCTTCGTCTCTCTTTCCACGACGCAATTGGATTCTCGATC
CACGGTTT
GGGAGGGGGTGCTGATGGCTCTATCCTGGCATTCAACAAAACCGAGAATGCCTTCCACGCCAATGGAGGAATCGACGACATCACCGACCGTCAATTCCCAGTCTTCCTCGAA
TCCAAACTCACTGCCGGAGATTT
CGTCCATCTCGCAGCTGCAGTCGGTACTGCTAACTGCCCTGGCGCTCCAAGACTCGAGTTCAAATTTGGCCGACCCGCGCCAAAGGCACCTGCACCC
GATCTTACCGTCCCAGAACCAACAGACAGTGTAACCAAGATTCTGGCCAGGTTCGCTGACGCTGGGTTTTCTCCTCAAGAGGCGGTCGCACTTCTCTCTTCCCACACCATTGCCGCTGCT
GATGTCGTTGATCCGACCATTCCAGGAACTCCTTTCGACTCCACCGTTGGCACTTTCGATACCCAAGTCTTCCTCGAAGTTCTCCTGAAGGGTCACTTGTTCCCCGGGAACGGATCTCAA
GCCGGAGAGGTCCTTTCTCCTCTCGCAGGAGAAATGCGCCTCCAGAGCGATTTCGCCATCTCCCAGGACTCGAGGACCGCTTGCTTCTGGCAAGCCATGGTTA
ATGACCAAAATCGCATG
GTAACCGAATTCAAGGCTGCGATGGCTAAGCTCCAGGTCCTCGGACAGAACACCGCTAAGCTAGTCGACTGCTCTGAT
ATCGTACCTGTCCCTAAATCCTTCACCACCAACATCAAGTTC
CCGGCTACATTCTCAAAGAAGGATGTCCAAATTGCG
TGCCCCAAACTTGCCTTCCCGAGTCTTGCTACTGTTGCCGGACCTGCTCCCACTATCCCTCCTGTGTAA

Retrieve as FASTA