Entry information : GmarCIIBC16
Entry ID 11893
Creation 2013-05-24 (Nizar Fawal)
Last sequence changes 2013-05-24 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC16
Name GmarCIIBC16
Class Other class II peroxidase type C    [Orthogroup: CIIBC002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC16
start..stop
S start..stop
GmarCIIBC03 531 0 1..344 1..358
GmarCIIBC15 519 0 1..344 1..349
GmarCIIBC08 517 0 1..344 1..348
GmarCIIBC11 488 6e-175 3..344 4..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3173867..3173993 127 N° 2 3173750..3173814 65 N° 3 3173647..3173701 55 N° 4 3173460..3173520 61
N° 5 3173275..3173340 66 N° 6 3173092..3173213 122 N° 7 3172940..3173034 95 N° 8 3172838..3172878 41
N° 9 3172672..3172722 51 N° 10 3172539..3172618 80 N° 11 3172446..3172481 36 N° 12 3172296..3172384 89
N° 13 3172162..3172239 78 N° 14 3172040..3172108 69  
complement(join(3172040..3172108,3172162..3172239,3172296..3172384,3172446..3172 481,3172539..3172618,3172672..3172722,3172838..3172878,3172940..3173034,3173092. .3173213,3173275..3173340,3173460..3173520,3173647..3173701,3173750..3173814,317 3867..3173993))


exon

Literature and cross-references GmarCIIBC16
DNA ref. JGI genome:   scaffold_2 (3173993..3172040)
Cluster/Prediction ref. JGI gene:   220286
Protein sequence: GmarCIIBC16
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (324)
PWM (Da):   %s   36146.02 (34089.9)  
PI (pH):   %s   4.25 (4.19) Peptide Signal:   %s   cut: 21 range:21-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFGRLAILVGLAASQLGSAATIQRRTVTCPTGQTTANQACCALFPVIDLLQKDLFDGGECGEEAHSALRIAFHDGIGFSKQGADGSILAFNTTETGYRKNLLIDDIVASQWPIFEQSGLSAGDFLHLAAAVGTGNCPGAPRLPYSMGRPAPVAPAPDLTVPEPTDSITDILARFADAGFVAPEVIWLLASHSIAAADKVDPTIPGTPFDSDTQFYLEVLLKGNQFPGTGQQNGEVLSPLAGEMRLQSDFAFSQDSRTACFWQEAINDQAFIMQKFSAAMQKLQVLGQTGLTDCSDVIPIPKSFAGPISYPASFAETDVQQACTATPFPSLATVAGPAPTVPPV*

Retrieve as FASTA  
Remarks complete sequence from genomics (13 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTTGGCCGTCTTGCAATCCTCGTCGGACTCGCTGCTTCCCAATTAGGCAGCGCAGCTACCATACAGAGGCGTACCGTCACCTGCCCCACAGGACAAACCACGGCTAACCAGGCC
TGCTGTG
GTGAGTTCATCGTGGTTTCTTAGCCGGCAGCTCGTCTAATGAATATTTCCAGCGCTGTTCCCAGTTATTGATCTTCTTCAAAAGGACCTTTTTGATGGCGGAGAGTGTGGTGA
AGAG
GTTGGCCTCCAGCGAATAACGTTTAATTTTGTGCTAACTATTATATAGGCTCATTCCGCCCTTCGTATTGCTTTCCATGACGGAATTGGCTTTTCTAAACAAGGTGACCTATTCTC
CATTTTTTTGAACGAACTTTCGAGTTAAAACATTATTTTTTAGGCGGAAAGTAGGCACCCCCCGTTTGCTCCAGCTTAATTTTTAATTAACAACGCACTCTCTAGGGGTGGAGGCGCTGA
CGGCTCCATTCTCGCTTTCAATACGACCGAAACTGGATACCGTAAGAATCTCCT
GTTTTATTTTTTGTTCCTTATCCATATTAACCCTTCCTATCCATTCGTTATGCAGATGCAAATAAC
GGGTGAGATTTTTTCCATGTGCATTGTCATCTTTCTCAAACTTAGTCGACTAGCATTGACGACATTGTCGCGAGCCAATGGCCGATCTTCGAACAAAGCGGTCTTTCTGCTGGAGACTTG
TAAGTAGCCTGCAAGTCGTATTGTAATACAATTCTAAGCGCTGATTCGCGGGGTATAAAGCCTTCACCTCGCTGCAGCTGTAGGTACCGGAAACTGCCCTGGAGCCCCGCGCCTCCCCTA
CTCAATGGGGCGTCCCGCTCCTGTTGCTCCGGCCCCTGACCTTACCGTCCCGGAGCCCACTG
GTAAGGCATATATAATACAATTTAACGTGACCGATCCTAAACCCCGAGAATTTTTAGA
CAGCATCACCGACATACTTGCAAGGTTTGCTGATGCCGGATTCGTTGCACCAGAAGTGATCTGGCTCCTTGCTTCGCATTCAATTGCTGCTGCG
GTGGGTGCTTTCTCCCTTCCGTTAAT
TTGGAATAAAATATTAATGTCCAATCCTTTATCAGGACAAAGTTGACCCAACCATCCCAGGAACCCCGTTCGATTCGTGAGTAGCGCTTTTCCATTTACACATTTTTGTCTCACCCCTCT
TGGCAGGACCCCCGGTACTTTGTATGTGCACACCCTACTTCTGGTTATCTCTCTCCTTAAATTGTGGGCAGTGACACACAGTTCTACCTCGAAGTCCTCTTAAAAGGAAACCAATTCCCT
GG
GTAAGTCGCGTCTTCATTTCCGCCAGAGCTTCGCGCTTATTTAGCTACATCAGAACCGGACAACAAAATGGCGAAGTTTTGTCCCCGCTCGCTGGTGAGATGCGCCTTCAAAGTGATT
TCGCGTTCTCGCAAG
GTCAGTGGCTTTAACGTATCTATCCTTCTTAATCGGTTTCTAACCCATAATAAAAAGATTCCAGAACTGCCTGCTTCTGGCAAGAGGCGATCAGTGCGTTTTTCT
CGAGCACTCAAGGATGTACATGACCTCTCATAATAATCAATATATTTAGACGACCAAGCGTTCATCATGCAGAAGTTCTCAGCAGCCATGCAGAAGCTGCAGGTTCTGGGGCAAACTGGC
CTTACCGATTGCTCTGAT
GTAATTCCATCCTTCCATCTAAATGATACATCTGATCTTACCCTTGCTGTACCTAGGTTATCCCCATTCCCAAGAGCTTCGCTGGTCCCATCTCGTATCCCG
CGAGCTTCGCCGAAACCGATGTTCAGCAAGCC
GTAAGTAACCTTCTCTGCAAATAATCCCCTCATATCTAACTTCTTTCAACTAGTGCACGGCCACACCTTTCCCCAGCCTCGCGACTGT
GGCCGGTCCCGCTCCTACCGTCCCACCGGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTTGGCCGTCTTGCAATCCTCGTCGGACTCGCTGCTTCCCAATTAGGCAGCGCAGCTACCATACAGAGGCGTACCGTCACCTGCCCCACAGGACAAACCACGGCTAACCAGGCC
TGCTGTG
CGCTGTTCCCAGTTATTGATCTTCTTCAAAAGGACCTTTTTGATGGCGGAGAGTGTGGTGAAGAGGCTCATTCCGCCCTTCGTATTGCTTTCCATGACGGAATTGGCTTTTCT
AAACAAG
GCGCTGACGGCTCCATTCTCGCTTTCAATACGACCGAAACTGGATACCGTAAGAATCTCCTCATTGACGACATTGTCGCGAGCCAATGGCCGATCTTCGAACAAAGCGGTCTT
TCTGCTGGAGACTT
CCTTCACCTCGCTGCAGCTGTAGGTACCGGAAACTGCCCTGGAGCCCCGCGCCTCCCCTACTCAATGGGGCGTCCCGCTCCTGTTGCTCCGGCCCCTGACCTTACC
GTCCCGGAGCCCACTG
ACAGCATCACCGACATACTTGCAAGGTTTGCTGATGCCGGATTCGTTGCACCAGAAGTGATCTGGCTCCTTGCTTCGCATTCAATTGCTGCTGCGGACAAAGTT
GACCCAACCATCCCAGGAACCCCGTTCGATTC
TGACACACAGTTCTACCTCGAAGTCCTCTTAAAAGGAAACCAATTCCCTGGAACCGGACAACAAAATGGCGAAGTTTTGTCCCCGCTC
GCTGGTGAGATGCGCCTTCAAAGTGATTTCGCGTTCTCGCAAG
ATTCCAGAACTGCCTGCTTCTGGCAAGAGGCGATCAACGACCAAGCGTTCATCATGCAGAAGTTCTCAGCAGCCATG
CAGAAGCTGCAGGTTCTGGGGCAAACTGGCCTTACCGATTGCTCTGAT
GTTATCCCCATTCCCAAGAGCTTCGCTGGTCCCATCTCGTATCCCGCGAGCTTCGCCGAAACCGATGTTCAG
CAAGCC
TGCACGGCCACACCTTTCCCCAGCCTCGCGACTGTGGCCGGTCCCGCTCCTACCGTCCCACCGGTGTAA

Retrieve as FASTA