Entry information : GmarAPx-CcP02
Entry ID 11895
Creation 2013-05-24 (Nizar Fawal)
Last sequence changes 2013-05-24 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarAPx-CcP02
Name GmarAPx-CcP02
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarAPx-CcP02
start..stop
S start..stop
GmarAPx-CcP01 718 0 1..469 1..467
GmarAPx-CcP06 691 0 12..469 8..470
GmarAPx-CcP08 555 0 65..470 6..402
GmarAPx-CcP03 531 0 9..477 1..467
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 570312..570551 240 N° 2 570168..570254 87 N° 3 570050..570116 67 N° 4 569678..569990 313
N° 5 569509..569628 120 N° 6 569278..569452 175 N° 7 568782..569225 444  
complement(join(568782..569225,569278..569452,569509..569628,569678..569990,5700 50..570116,570168..570254,570312..570551))


exon

Literature and cross-references GmarAPx-CcP02
DNA ref. JGI genome:   scaffold_10 (570551..568782)
Cluster/Prediction ref. JGI gene:   65799
Protein sequence: GmarAPx-CcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   482 (461)
PWM (Da):   %s   52292.46 (50026.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.51 (6.35) Peptide Signal:   %s   cut: 26 range:21-481
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPAASIINLIIWTLFIPASTLFVSGDYTWPSPQHDALEKFLYEGIDASDLNLAGLASFCSKRFGPSPFELSTFSAEWVRLAYHDMATHNVTDGTGGLDASIFYELDRPENIGAGNINSVNDFRTHTSKLVSRSDIIAMGVVWGVAGCGGPAIPFRYGRKDAFKPGRSGVPEPQQELTSHIESFRLQGFTETEMIGLVACGHTLGGVRSVDFQDIVPDPTNFSLATFDTTPAFDHVIVSEYLNSSTQNPLIKVPSGNTTFASDRRIFGIGQNATMKGLNSKTSFFKTCQTLLARMIDTVPSNVQLSDVVTLLPVKVTDAQITVIDSQLVFMTTLLAHPININATAARNVRMFWCDNRGILKNCNRVTNVASLPFQDGSFTSPLTDSLNIQLTLYNFKVPISAARSVSKFWFEVDGVIHNNGGKGYPILQDEIIHVPWLGSFNKAFSQPGPTSTSLGLSETTFNLVVGVSAPASSARACFKI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCCGCCTCTATTATCAATCTTATTATCTGGACATTGTTCATACCGGCGTCAACTCTATTTGTCTCCGGCGACTATACTTGGCCGTCCCCACAACATGATGCCCTCGAGAAATTT
CTATACGAAGGCATCGACGCAAGTGACTTGAACCTCGCAGGATTGGCATCCTTCTGCTCCAAAAGATTTGGTCCTAGCCCATTCGAATTGTCCACATTCTCTGCTGAATGGGTGCGACTG
GTAAGTTCAATTTAACTACATGCAAAGAAAGCATCCGAAAATCAATCTTTGCCTCAGGCTTACCATGATATGGCTACTCATAATGTTACTGATGGAACAGGCGGTTTGGATGCTTCGATA
TTCTATGAACTCGACAGACCAGAG
GTAATAACACTTTCACTTAATTCTAAAATCTTTTTTAATTTGATCTTCCAGAACATTGGCGCCGGAAATATTAACTCAGTCAATGATTTCAGAACC
CATACAAGCAAACTCGTATCTC
GTGAGTAACAAATTCCTCGTCTCAAAGTCGCCCTTGAAACTGAACAGTCCGATTCAAAGGATCTGATATCATTGCCATGGGTGTCGTCTGGGGCGTCG
CAGGATGTGGGGGTCCTGCAATACCTTTTCGATACGGAAGGAAAGACGCCTTTAAGCCCGGGAGATCTGGAGTTCCAGAACCACAGCAAGAACTTACCAGTCACATAGAAAGTTTCCGTC
TTCAAGGATTTACCGAAACAGAGATGATAGGACTTGTGGCATGCGGACATACTCTCGGAGGCGTCAGGAGCGTTGACTTTCAAGATATTGTGCCTGACCCAACAAATTTCAGCCTCGCGA
CGTTCGATACCACACCTGCTTTCGATCATGTCAT
GTACGAATTTCTTCTGAGCAGTTTGGCTGAAGCTAAAAAAATCATTTAGTGTCAGCGAATATTTAAACTCGTCTACACAAAATCCA
TTGATCAAGGTCCCATCAGGGAATACAACGTTCGCTTCAGATCGGCGAATATTTGGCATCGGTCAAAATGCCACCATGAAAGG
GTACGCTGAATCATACAGTTAATTGGCTATGTACATC
GCTAAATGGTCTACCGTAGGCTTAATTCGAAAACATCTTTCTTTAAAACTTGCCAAACTTTACTAGCAAGGATGATTGACACTGTGCCGTCAAATGTCCAGCTCAGCGATGTAGTCACCC
TCCTTCCGGTGAAGGTGACCGATGCACAAATTACAGTTATCGATTCGCAGCTCGTTTTCATGACAACCCTAAGG
GTACGTTCGAAGTTATCAGAGGAAATGTACTGACTTATAATGCTTT
TCTCAGTTGGCCCATCCTATTAACATTAATGCTACGGCAGCCAGGAATGTGCGGATGTTTTGGTGCGATAACCGGGGCATCCTCAAGAACTGCAACCGAGTCACCAATGTTGCATCACTC
CCATTCCAGGACGGATCATTCACATCTCCGTTAACTGATTCCTTAAATATCCAATTAACGTTGTACAATTTCAAGGTCCCTATCTCAGCCGCTCGGTCTGTCTCAAAGTTTTGGTTCGAG
GTCGACGGGGTCATCCACAACAACGGAGGGAAAGGCTACCCAATACTCCAGGATGAAATCATACATGTCCCGTGGCTGGGAAGTTTTAACAAAGCTTTTTCACAACCAGGACCAACAAGT
ACATCGCTTGGATTGTCTGAAACGACTTTTAATCTGGTTGTCGGTGTAAGTGCCCCTGCCTCATCTGCTCGAGCGTGTTTTAAAATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCCGCCTCTATTATCAATCTTATTATCTGGACATTGTTCATACCGGCGTCAACTCTATTTGTCTCCGGCGACTATACTTGGCCGTCCCCACAACATGATGCCCTCGAGAAATTT
CTATACGAAGGCATCGACGCAAGTGACTTGAACCTCGCAGGATTGGCATCCTTCTGCTCCAAAAGATTTGGTCCTAGCCCATTCGAATTGTCCACATTCTCTGCTGAATGGGTGCGACTG
GCTTACCATGATATGGCTACTCATAATGTTACTGATGGAACAGGCGGTTTGGATGCTTCGATATTCTATGAACTCGACAGACCAGAGAACATTGGCGCCGGAAATATTAACTCAGTCAAT
GATTTCAGAACCCATACAAGCAAACTCGTATCTC
GATCTGATATCATTGCCATGGGTGTCGTCTGGGGCGTCGCAGGATGTGGGGGTCCTGCAATACCTTTTCGATACGGAAGGAAAGAC
GCCTTTAAGCCCGGGAGATCTGGAGTTCCAGAACCACAGCAAGAACTTACCAGTCACATAGAAAGTTTCCGTCTTCAAGGATTTACCGAAACAGAGATGATAGGACTTGTGGCATGCGGA
CATACTCTCGGAGGCGTCAGGAGCGTTGACTTTCAAGATATTGTGCCTGACCCAACAAATTTCAGCCTCGCGACGTTCGATACCACACCTGCTTTCGATCATGTCAT
TGTCAGCGAATAT
TTAAACTCGTCTACACAAAATCCATTGATCAAGGTCCCATCAGGGAATACAACGTTCGCTTCAGATCGGCGAATATTTGGCATCGGTCAAAATGCCACCATGAAAGG
GCTTAATTCGAAA
ACATCTTTCTTTAAAACTTGCCAAACTTTACTAGCAAGGATGATTGACACTGTGCCGTCAAATGTCCAGCTCAGCGATGTAGTCACCCTCCTTCCGGTGAAGGTGACCGATGCACAAATT
ACAGTTATCGATTCGCAGCTCGTTTTCATGACAACCCTAAGG
TTGGCCCATCCTATTAACATTAATGCTACGGCAGCCAGGAATGTGCGGATGTTTTGGTGCGATAACCGGGGCATCCTC
AAGAACTGCAACCGAGTCACCAATGTTGCATCACTCCCATTCCAGGACGGATCATTCACATCTCCGTTAACTGATTCCTTAAATATCCAATTAACGTTGTACAATTTCAAGGTCCCTATC
TCAGCCGCTCGGTCTGTCTCAAAGTTTTGGTTCGAGGTCGACGGGGTCATCCACAACAACGGAGGGAAAGGCTACCCAATACTCCAGGATGAAATCATACATGTCCCGTGGCTGGGAAGT
TTTAACAAAGCTTTTTCACAACCAGGACCAACAAGTACATCGCTTGGATTGTCTGAAACGACTTTTAATCTGGTTGTCGGTGTAAGTGCCCCTGCCTCATCTGCTCGAGCGTGTTTTAAA
ATATAA

Retrieve as FASTA