Entry information : AtPrx26 (At2g43480 / PER26 / AtperoxP26 / ATP50)
Entry ID 119
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-12-13 (Catherine Mathe)
Peroxidase information: AtPrx26 (At2g43480 / PER26 / AtperoxP26 / ATP50)
Name (synonym) AtPrx26 (At2g43480 / PER26 / AtperoxP26 / ATP50)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx26
start..stop
S start..stop
AhalPrx12 684 0 1..335 1..335
AlyPrx26 677 0 1..335 1..335
BstrPrx74 660 0 1..335 1..335
CagraPrx40 659 0 1..335 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18053009..18053254 246 N° 2 18053419..18053598 180 N° 3 18053681..18053840 160 N° 4 18053929..18054350 422
join(18053009..18053254,18053419..18053598,18053681..18053840,18053929..18054350 )


exon

Literature and cross-references AtPrx26 (At2g43480 / PER26 / AtperoxP26 / ATP50)
Protein ref. UniProtKB:   O22862
DNA ref. Phytozome 11:   Chr2 (18053009..18054350)
mRNA ref. GenBank:   NM_129909
Cluster/Prediction ref. Phytozome Gene 11:   19643264 UniGene:   At.36889
Omic ref. AtProteome:   At2g43480 ATTED-II:   At2g43480 e-FP Browser:   At2g43480 ePlant:   At2g43480 Genevestigator:   At2g43480 TAIR:   At2g43480
Protein sequence: AtPrx26 (At2g43480 / PER26 / AtperoxP26 / ATP50)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (317)
PWM (Da):   %s   37429.73 (35502.7)  
PI (pH):   %s   8.37 (8.37) Peptide Signal:   %s   cut: 26 range:19-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVMIHIFLTVMVVGGVSLFPETAEAIVMGPSMQKLTWHYYKVYNTCENAENFVRHQVEIFYKNDKSIAPKLLRLLYSDCFVSGCDASVLLEGPNSEKMAPQNRGLGGFVLIDKIKIVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVFTGRRDGLTSDKQTVDLPSPSISWDQAMSYFKSRGLNVLDMATLLGSHSMGRTHCSYVVDRLYNYNKTGKPSPTMNKYFLSEMAKQCPPRTRKGQTDPLVYLNPDSGSNHSFTSSFYSRILSNKSVLEVDQQLLYNDDTKQISKEFSEGFEDFRKSFALSMSKMGAINVLTKTEGEIRKDCRHIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns) and 2 cDNA. No EST. Containing motif 'YSDC'.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGATCATGAA CAAAATTGTA AACCTAGGTT TGATTCTCAT GAAACTAAAA GCAAAATTTG ATCATAAAGA ATTCACAAAC CTATCAAGGA GTTGAATCAG AATGTCGTCT TCTGCAGTGG  TCCAATTCAA GGCGATTCCC GAGCGACTTA TCAACAATGA GCTCTCCGAC GGTGTGGTCA AGTTGCCGGA GTAGGCATTA TTATGATTCA TCTCTTCGTT TGTCTAAAGC CCTAGTTTAT  CGTATAACTA CGTACAATGT GTACGGATGT GGATAAATAT ACGTAAATAT TCAGGTAATC TTGAAATCCT TCTAGAAGAG GTGTACGGAA ATATATTTTT TTTGGGTGAA TAGGTGTAAG  GAAATATTAA AAAGAACAAC AACAAAAATA AATCAAGCGA ACAATATCAA CGCAGATCTA CGACGATCGG CGATATCTGA TTCGTAATTC AAGCGAACGA TGGGGGCAAA TAAATCAAAA  TTCCCAGAAA AGCCAGAAAA GCGAAGTCGA GATTGAATTG CTAGAGAGAG AAGAAGATGA AAACAGGAAC TTCTAGAGAG AGGGAAAACA AAAGAATGTC AGCTTTGTTT TAGGCTTTGG  GTCGGTAAAG TAGGTTAGGT TGTAATTTAT AATAACGCAT ATGCTCCCTT AATTATCAAT ATAATTTGAT TTGTTGGGGA TAATTAATTT TCTTATTGAG TCGTCCTTTT TTTTGTAGGA  TCATGCATAC TGTATATGAT CTGAAATATA TATTTAGAAT CATGGACGAC GTATTTCCCG GGATATTGTG CGATGGGATT CGGTAGAGAC AATGTTAAGG GTAGCTATAA AGTAGTGAGG  ATCTTCCGTG ATCCTACCTA TTGCGATATC CTTGATGTCA ACACTGGTGA ATGTCTAATT CTTTTGTGTA TTTCAGTACT GATGCTTCAT TACTTCTATC GAAAATTGAG GTTGATCTAA  CTGTGGAAAA TTTAATGTGA AATGAAAAAC GGATTTGTCT AATTTATCAT TATTCGATCA TTTGCCCATT ATTTCCTATC GTCGTCGTTC AAATTATTAT TGGACCAGTG AAATAAAAAT  CCGTAGTTAT TGTGCTACAA TCACGATCAG TATTTTGTGG GAATTTTCAA TCAAAATCAT CCTTTATATT TAGATATTAG AAACAGTCTT ATACACTATA ATAATTTATA ATAAGAACAA  AAACTATATA AAAAAAGAAA GCAAAAAGAG AAATGGGGTC TCATAATTTT GCATGGGAAA TCAAACGACG CGCAGAATCC GAGTTACGAT CACATGTTCA CACGTTGCTT CACTAATCTA  AACGATCAAA ACGTAAACGA TATACTGTAC ATTTGCTTAA TTAGTTGATA TTTCAATAAA TTACACGAAG AATATTAGTT TTAAAAAAAT TTAGTATTTC TATATCTCAA ACTTCAATCG  TGATAACAAT TATTTTCTCT TTTGACCTTT GCTTCTTACA TGTCAGTATG TCACATATGT AAGATCTCCT TTGCCCAAAA AAAAATAAAA ATGTAAGACC TTTATCTATA AACCCCAATC  TGAATTTAGT TCCATTTCAA ATTTTCACTA AAATGCTATT AAAAAGGATT CTATGTATTT CAATTATCAA ATCATCGTCT TTATCTAAAA CCTATTTTTA CTTTCATGCA AATTAGTAGT  TCAAAAAAAA TCAAAAAGTA GACACAGCAA TTAAATGCCT AGACGACATT GGGCTGGCCA CTTAGCTTGC ACGGCACATA AACGAAACTC AACAAGATCC GATAATTATG CTTGCACAAC  TTTGTATTTC AATTTAATTT TAAGGACCTT ACTATATACT TAAGAATTAA TCCTAGTCAG ATATGCCACG TGGACAAAAA CCCATAAGTG CCCTCACAAT CTATCAATCT CTACGTATAT 
AAACCCTCAC TAGTAGTACT CAAAAACACA CCTCTTTGGC TTCTCTATTC AACACTCAAC AGTCAACAGC TTCACCTTGA G 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACACAAAAGC ACAATCTCTC TCTCACCACT GTGATACCAA GAAGAATAAA CACAAGGTAT AAACAGGAAA CAAGATTGAA ATATTTATGT TTCAGATATA AATTTGTTAT CATTTATTAC  ATTGTAATCA CCGTGAGAAA GGCTTCTCTA TAGCTAAAGG AGATTGATTC TTTTGGTGTT TCTAAAAAAG TAGAATTTTT TTTCTTCTGA TATTCACATA AGTATAAAGG GTATGCAGTC  AAAATTGTTC CCGCACAAAA GAGAAAGGAG ATTTTATTTG TCTAACCTCT TTGGTTATGA GTCTTAGACT CTCTGTTTAA GAAGTACCAA GCGATTGAAT TTCACAAGCT TCTCAATCTC  TTGCTAGTTC CTTCCTGTTA GCTTCAAGAA GAGGCCAAAC AATTATAAGA ATATAAATTT TATTACATAA ACAACAAAAT CGCAAAGGCT TTAGTAGCGA TTAAGATTTA TCATAGCTTA  TGTAAGATTA TTTGCCAACA CTTCCTGGTA TATATGTTTA CAAGTTATGA TTTTTTTCTT GAACCAATAT TTCATTACGT GTGAACATAT TCTTCAGGTG AAAACGGTTA CCTCAAAAAA  GTTGTCAAAC ATGTTGTAGA CACAGATCAA AGCATGAATC TTCAAACATA AACCCCTTCC TCGTAATCCG TAACTAAAGA TGACCTACTT GTGTGAGCTT CTATTTCTTC TTCTTTTTGT  TTTATACTTT TTAACTGTTA TAGGTGGAAT CCCGCCTAGT CACCATTCTG AGTGGCAGGA CTATGATGAA AACTTGGTGT TTGGCTCTGG TTCTCACCAT GGCTCTGAAT CTCCTCCGGC  CTCTGGCTCT CCATATGGGT TTGATGCTGG ATATGAACCT GGTTGAGATT CTGAGACTGA GTGTGACTCT TAGTCTTGAT TACCTGACTC TAACAAGCGT TTTAACAGTT AAATGGAGAA 
AATAGAATAA TCCAGCAGCA GAAGCTTTCT TTGTAGAGCA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTATGATTCATATCTTCCTCACCGTGATGGTGGTTGGAGGCGTCAGTCTCTTCCCGGAGACGGCAGAAGCGATCGTGATGGGACCGTCGATGCAGAAGCTGACGTGGCATTACTAT
AAAGTTTACAACACTTGCGAGAATGCAGAGAATTTTGTGAGGCACCAAGTTGAGATATTTTACAAGAACGATAAAAGTATTGCTCCTAAGCTCCTTCGTCTCCTCTACTCAGACTGCTTT
GTTTCC
GTACGTTTTTCTTATTCTTGTCTTATCATTTAATCAATTATGAACCCAATGGCATATAGAAGTGTAAGTTTGTAACCACAAAACTAATCGAGTGCTAAGAAAGTTTAATTAGAA
GATTTACTAATTACTGCTCTCACATTGTGCGACACTATCTATAATGATAGGGATGCGATGCATCAGTTCTTCTAGAAGGTCCAAACTCAGAGAAAATGGCGCCACAAAACAGAGGACTTG
GAGGATTCGTTCTCATAGACAAAATCAAAATAGTCTTGGAACAGAGATGTCCTGGTGTTGTCTCTTGCGCCGACATTCTTAATCTTGCAACTCGTGATGCTGTTCATTTG
GTAATCTCTC
TTTCTTCTGCACCTATAGCTGTACATGGATCATTAATAGATACTGACCAGCTTAGAGAACTGATTCATTCAGGCGGGTGCACCATCTTATCCTGTGTTCACAGGCAGGAGAGATGGTTTG
ACGTCTGATAAGCAAACCGTGGACCTACCATCGCCATCCATCTCATGGGACCAAGCCATGTCTTATTTCAAATCCAGAGGCTTGAATGTTCTTGACATGGCTACACTTCTAG
GTCAGTCA
CCTTTTTTCTTCCTGCCAATATCTTAAAAACCGGTTTTGTTCTGGTTTGAATCGCTTAAACTGAGTTACTCCCTAATCAGGATCACATTCAATGGGGAGAACACATTGCAGCTATGTTGT
TGATCGACTCTACAATTACAACAAGACCGGTAAACCAAGCCCTACTATGAACAAGTATTTCCTATCTGAAATGGCAAAGCAATGTCCTCCAAGAACGAGGAAAGGCCAGACCGATCCGCT
CGTGTACCTAAACCCGGACTCAGGCTCAAACCACAGCTTCACAAGCTCATTTTACTCAAGAATTCTATCAAACAAATCTGTACTTGAAGTAGATCAACAACTGCTTTACAATGATGACAC
CAAGCAAATATCTAAGGAATTCTCAGAGGGTTTCGAGGATTTTCGGAAATCATTTGCTCTTTCGATGAGCAAGATGGGAGCGATAAATGTGTTAACTAAAACGGAAGGTGAGATACGAAA
AGATTGCAGGCATATAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTATGATTCATATCTTCCTCACCGTGATGGTGGTTGGAGGCGTCAGTCTCTTCCCGGAGACGGCAGAAGCGATCGTGATGGGACCGTCGATGCAGAAGCTGACGTGGCATTACTAT
AAAGTTTACAACACTTGCGAGAATGCAGAGAATTTTGTGAGGCACCAAGTTGAGATATTTTACAAGAACGATAAAAGTATTGCTCCTAAGCTCCTTCGTCTCCTCTACTCAGACTGCTTT
GTTTCC
GGATGCGATGCATCAGTTCTTCTAGAAGGTCCAAACTCAGAGAAAATGGCGCCACAAAACAGAGGACTTGGAGGATTCGTTCTCATAGACAAAATCAAAATAGTCTTGGAACAG
AGATGTCCTGGTGTTGTCTCTTGCGCCGACATTCTTAATCTTGCAACTCGTGATGCTGTTCATTTG
GCGGGTGCACCATCTTATCCTGTGTTCACAGGCAGGAGAGATGGTTTGACGTCT
GATAAGCAAACCGTGGACCTACCATCGCCATCCATCTCATGGGACCAAGCCATGTCTTATTTCAAATCCAGAGGCTTGAATGTTCTTGACATGGCTACACTTCTAG
GATCACATTCAATG
GGGAGAACACATTGCAGCTATGTTGTTGATCGACTCTACAATTACAACAAGACCGGTAAACCAAGCCCTACTATGAACAAGTATTTCCTATCTGAAATGGCAAAGCAATGTCCTCCAAGA
ACGAGGAAAGGCCAGACCGATCCGCTCGTGTACCTAAACCCGGACTCAGGCTCAAACCACAGCTTCACAAGCTCATTTTACTCAAGAATTCTATCAAACAAATCTGTACTTGAAGTAGAT
CAACAACTGCTTTACAATGATGACACCAAGCAAATATCTAAGGAATTCTCAGAGGGTTTCGAGGATTTTCGGAAATCATTTGCTCTTTCGATGAGCAAGATGGGAGCGATAAATGTGTTA
ACTAAAACGGAAGGTGAGATACGAAAAGATTGCAGGCATATAAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTTGAGATG GTTATGATTC ATATCTTCCT CACCGTGATG GTGGTTGGAG GCGTCAGTCT CTTCCCGGAG ACGGCAGAAG CGATCGTGAT GGGACCGTCG ATGCAGAAGC TGACGTGGCA  TTACTATAAA GTTTACAACA CTTGCGAGAA TGCAGAGAAT TTTGTGAGGC ACCAAGTTGA GATATTTTAC AAGAACGATA AAAGTATTGC TCCTAAGCTC CTTCGTCTCC TCTACTCAGA  CTGCTTTGTT TCCGGATGCG ATGCATCAGT TCTTCTAGAA GGTCCAAACT CAGAGAAAAT GGCGCCACAA AACAGAGGAC TTGGAGGATT CGTTCTCATA GACAAAATCA AAATAGTCTT  GGAACAGAGA TGTCCTGGTG TTGTCTCTTG CGCCGACATT CTTAATCTTG CAACTCGTGA TGCTGTTCAT TTGGCGGGTG CACCATCTTA TCCTGTGTTC ACAGGCAGGA GAGATGGTTT  GACGTCTGAT AAGCAAACCG TGGACCTACC ATCGCCATCC ATCTCATGGG ACCAAGCCAT GTCTTATTTC AAATCCAGAG GCTTGAATGT TCTTGACATG GCTACACTTC TAGGATCACA  TTCAATGGGG AGAACACATT GCAGCTATGT TGTTGATCGA CTCTACAATT ACAACAAGAC CGGTAAACCA AGCCCTACTA TGAACAAGTA TTTCCTATCT GAAATGGCAA AGCAATGTCC  TCCAAGAACG AGGAAAGGCC AGACCGATCC GCTCGTGTAC CTAAACCCGG ACTCAGGCTC AAACCACAGC TTCACAAGCT CATTTTACTC AAGAATTCTA TCAAACAAAT CTGTACTTGA  AGTAGATCAA CAACTGCTTT ACAATGATGA CACCAAGCAA ATATCTAAGG AATTCTCAGA GGGTTTCGAG GATTTTCGGA AATCATTTGC TCTTTCGATG AGCAAGATGG GAGCGATAAA 
TGTGTTAACT AAAACGGAAG GTGAGATACG AAAAGATTGC AGGCATATAA ACTAAACACA AAAGCACAAT CTCTCTCTCA CCACTGTGAT AC 

Retrieve as FASTA