Entry information : GmarAPx-CcP04
Entry ID 11912
Creation 2013-05-27 (Christophe Dunand)
Last sequence changes 2013-05-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarAPx-CcP04
Name GmarAPx-CcP04
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarAPx-CcP04
start..stop
S start..stop
GmarAPx-CcP05 513 1e-180 1..333 1..341
GmarAPx-CcP07 498 9e-175 13..333 13..340
GmarAPx-CcP03 490 2e-171 1..333 1..340
GmarAPx-CcP02 422 8e-147 1..333 9..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 222259..222456 198 N° 2 222110..222196 87 N° 3 221993..222059 67 N° 4 221609..221921 313
N° 5 221433..221546 114 N° 6 221203..221377 175 N° 7 220985..221140 156  
complement(join(220985..221140,221203..221377,221433..221546,221609..221921,2219 93..222059,222110..222196,222259..222456))


exon

Literature and cross-references GmarAPx-CcP04
DNA ref. JGI genome:   scaffold_38 (222456..220985)
Cluster/Prediction ref. JGI gene:   230872
Protein sequence: GmarAPx-CcP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370 (351)
PWM (Da):   %s   40386.17 (38468.1)  
PI (pH):   %s   5.96 (5.65) Peptide Signal:   %s   cut: 19 range:19-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLSSFVVVLSILTTISAYTWPSPQYDALEKFLYEGIDNNGRGIASLTSGCAKRVQSTFAAEWLRVAYHDMATHNVTDGTGGLDASIFRELTRPENVGAGMKDTMIDFQYSASKYISLSDIIAMGAVWGVASCNGPSLPYRGGRRDATGPGREGVPRPQQDLASHTETFRLQGFTPTEMISLIACGHTLGGVRSGDFPNLVDAKTGFEISTFDTTDAFDTAVVSEYLDSSTKNPLIRTANTTLASDLRIFSSDGDVTMNSLNSKSAYFQTCRTLLTRMLDTVPSNVTLTDEIKLLPAKVTNAQITVNNSQLLFYTTLRLSQRVNVSTPSNRQVTCGCVGHCFAWQIRDLIRIFFESPLVHILYQENDRG

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCCTCAGTTCATTCGTGGTCGTATTATCCATCCTAACTACTATATCGGCTTACACATGGCCTTCGCCACAATATGACGCACTCGAAAAGTTCCTATACGAGGGTATCGATAACAAC
GGCAGGGGAATCGCTAGTCTCACCAGTGGTTGTGCCAAGAGAGTACAATCGACGTTCGCAGCGGAATGGCTTCGTGTT
GTACGCTTTCTCTCGTTTTATTTTCTCAGGTTGTATTCGGGT
TTCTGATTAAGATTTTGTAGGCATACCACGATATGGCAACCCATAATGTCACTGATGGAACGGGCGGGCTTGATGCTTCGATATTCCGCGAATTGACCCGACCGGAGGTTCAGAAATTTC
GTACTTCACATATATTCTGGCTAATTTTTCTACCTAGAACGTTGGCGCTGGCATGAAGGATACCATGATTGATTTTCAATATTCAGCAAGCAAATATATATCCCGTGAGTCAACATTGAA
CGTTGATCTTTCTGGTCGATACATAGACCCTGACTAATTTCGGTCCATTCCAAAGTTTCTGATATCATTGCGATGGGAGCTGTATGGGGTGTTGCATCGTGTAACGGCCCTTCCCTTCCC
TATCGAGGTGGGCGAAGAGATGCCACAGGACCTGGACGCGAAGGCGTCCCACGACCGCAGCAAGATCTAGCCTCTCATACGGAGACCTTTCGTCTACAAGGATTTACACCGACCGAGATG
ATCAGCCTGATCGCCTGTGGCCACACCCTTGGAGGTGTACGCAGCGGTGATTTTCCCAACCTCGTGGACGCCAAAACTGGTTTCGAGATTTCGACCTTCGATACGACGGATGCCTTTGAT
ACTGCCGT
GTTAGTTCGATGAACTCCTGACTTTTGTTTCTTTAATACTGATGTTTCACTAACACGATTAGAGTGAGCGAATATTTAGATTCCTCGACCAAAAACCCCCTGATCCGGACGG
CCAATACTACGCTGGCGTCAGACCTTCGGATATTCAGCAGCGATGGAGACGTAACCATGAATAG
GTTGGTCGTCTACTGTCTCCCTCGAAAAGCCAGTTCCTTATCTTAATTCTGACAGC
CTGAACTCTAAGAGTGCTTACTTCCAAACATGCAGAACATTGTTGACAAGGATGCTTGATACCGTCCCTTCCAACGTGACATTGACAGACGAAATCAAGCTTTTGCCAGCAAAGGTCACG
AACGCTCAAATTACGGTGAACAATTCACAACTCCTTTTTTATACAACACTACGC
GTAAGTCTTGCTTTAAATTTAATTTAATTAATGGTTCATAAGCTGTACCTTAATTTCACTAGCTAT
CGCAACGGGTCAATGTATCTACACCTTCCAATCGACAAGTCACGTGCGGGTGTGTCGGCCACTGCTTCGCATGGCAAATACGAGACCTTATTAGAATATTTTTTGAAAGTCCGCTGGTAC
ACATACTGTATCAAGAAAATGACCGTGGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCCTCAGTTCATTCGTGGTCGTATTATCCATCCTAACTACTATATCGGCTTACACATGGCCTTCGCCACAATATGACGCACTCGAAAAGTTCCTATACGAGGGTATCGATAACAAC
GGCAGGGGAATCGCTAGTCTCACCAGTGGTTGTGCCAAGAGAGTACAATCGACGTTCGCAGCGGAATGGCTTCGTGTT
GCATACCACGATATGGCAACCCATAATGTCACTGATGGAACG
GGCGGGCTTGATGCTTCGATATTCCGCGAATTGACCCGACCGGAG
AACGTTGGCGCTGGCATGAAGGATACCATGATTGATTTTCAATATTCAGCAAGCAAATATATATCCCTTTCTGAT
ATCATTGCGATGGGAGCTGTATGGGGTGTTGCATCGTGTAACGGCCCTTCCCTTCCCTATCGAGGTGGGCGAAGAGATGCCACAGGACCTGGACGCGAAGGCGTCCCACGACCGCAGCAA
GATCTAGCCTCTCATACGGAGACCTTTCGTCTACAAGGATTTACACCGACCGAGATGATCAGCCTGATCGCCTGTGGCCACACCCTTGGAGGTGTACGCAGCGGTGATTTTCCCAACCTC
GTGGACGCCAAAACTGGTTTCGAGATTTCGACCTTCGATACGACGGATGCCTTTGATACTGCCGT
AGTGAGCGAATATTTAGATTCCTCGACCAAAAACCCCCTGATCCGGACGGCCAAT
ACTACGCTGGCGTCAGACCTTCGGATATTCAGCAGCGATGGAGACGTAACCATGAATAG
CCTGAACTCTAAGAGTGCTTACTTCCAAACATGCAGAACATTGTTGACAAGGATGCTTGAT
ACCGTCCCTTCCAACGTGACATTGACAGACGAAATCAAGCTTTTGCCAGCAAAGGTCACGAACGCTCAAATTACGGTGAACAATTCACAACTCCTTTTTTATACAACACTACGC
CTATCG
CAACGGGTCAATGTATCTACACCTTCCAATCGACAAGTCACGTGCGGGTGTGTCGGCCACTGCTTCGCATGGCAAATACGAGACCTTATTAGAATATTTTTTGAAAGTCCGCTGGTACAC
ATACTGTATCAAGAAAATGACCGTGGTTAG

Retrieve as FASTA