Entry information : GmarAPx-CcP06
Entry ID 11914
Creation 2013-05-27 (Christophe Dunand)
Last sequence changes 2013-05-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarAPx-CcP06
Name GmarAPx-CcP06
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarAPx-CcP06
start..stop
S start..stop
GmarAPx-CcP01 830 0 7..479 11..476
GmarAPx-CcP02 691 0 8..470 12..469
GmarAPx-CcP08 652 0 98..479 33..410
GmarAPx-CcP03 523 0 11..469 6..458
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 983461..983694 234 N° 2 983747..983833 87 N° 3 983890..983956 67 N° 4 984012..984336 325
N° 5 984386..984505 120 N° 6 984561..984735 175 N° 7 984792..985247 456  
join(983461..983694,983747..983833,983890..983956,984012..984336,984386..984505, 984561..984735,984792..985247)


exon

Literature and cross-references GmarAPx-CcP06
DNA ref. JGI genome:   scaffold_10 (983461..985247)
Cluster/Prediction ref. JGI gene:   95393
Protein sequence: GmarAPx-CcP06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   488 (464)
PWM (Da):   %s   52762.53 (50049.1) Transmb domain:   %s   i7-29o463-485i (o440-462i)
PI (pH):   %s   4.96 (4.96) Peptide Signal:   %s   cut: 24 range:24-487
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSITASFWIFFIPLSIVISFVSAEYTWPSAQHDALEQFLYEGTHVTGDNVAGLARFCLPRFLPGGDQPSSVAAEWVRLAYHDMATHNATDGTGGLDGSIFYELDRPENVGAGNVNTVGDFKDHSSKLVSRSDIIAMGAVWAVAACGGPPIPFRYGRKDALKAGRSGVPEPQQNLASHIESFRLQGFTQKEMIGLVACGHTLGGVRGVDFQDIVPDPSISSIATFDTTSGLDSAFDHLIVTQYLNSSTQNPLIRVPSGNSTFASDLRIFSSDQNATMKGLNSETSFSQTCTTLLAKMIDTVPSNVHLSDVVTLLPVKVSNAQITAIDSQLVFMTDLVAFPAGISPTAASKVQMFWCDSRGVFKNCNRVTNVASLPFLDEPSTSPLTDSLNIQLVLYRFKVQISASRSVSKFWFEIDGAIHNNGGNGYPIGQDEIIFVPSLGSVDPKFLQPDPANPSEFLPRNYNLVFGVSVTPLITNEFILIVIYCR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTATCACCGCTTCTTTCTGGATATTTTTTATACCGCTGTCAATAGTGATTTCATTTGTTTCAGCCGAGTATACCTGGCCGTCGGCACAGCACGACGCCCTCGAACAGTTTCTATAC
GAAGGCACCCATGTAACCGGTGACAATGTCGCCGGTTTGGCACGTTTCTGCCTTCCCAGATTTCTCCCTGGAGGAGACCAGCCATCTTCAGTCGCGGCCGAGTGGGTACGCCTG
GTAAGT
GTATTCAAAATTCAAATGGTCGGAAGAGATTTGATCATATCATCAGGCATACCATGATATGGCTACTCATAATGCAACTGACGGTACAGGCGGGCTAGATGGTTCTATATTCTACGAACT
TGACAGACCAGAG
GTAAAAAAATCCAATGTAAATTTCCTAAAATACGACTCAAATTTTTGAAATAACAGAACGTCGGTGCCGGAAACGTCAACACGGTCGGGGATTTCAAGGACCATTCA
AGCAAACTCGTATCTA
GTGAGAGACTGCCTAATTCGAAGTCGTCCTTGAAGCTAAACTGCTCGATTCAAAGGATCCGATATTATTGCGATGGGTGCCGTCTGGGCCGTGGCAGCATGTGG
TGGTCCTCCGATACCATTCCGATATGGGAGGAAAGACGCCTTGAAAGCAGGACGATCTGGAGTTCCAGAGCCACAGCAAAATCTTGCCAGCCACATAGAAAGCTTCCGCCTTCAAGGATT
CACACAAAAAGAAATGATTGGACTTGTCGCATGCGGACATACCCTTGGAGGAGTTCGGGGCGTTGACTTTCAGGACATCGTGCCTGATCCATCGATTTCTAGTATCGCGACGTTCGATAC
CACGTCCGGCCTCGACTCAGCCTTTGATCACCTTAT
GTACGAATTCCTGCAGAGCAATTGGGGCAATGCTAATGCAAGGATTTAGTGTCACCCAATACTTAAACTCCTCCACTCAAAACC
CTTTGATCAGGGTGCCGTCAGGAAATTCAACGTTCGCATCAGATCTGCGAATATTTAGCAGCGACCAGAATGCCACCATGAAAGG
GTATGTAAAACCAAACATCTATATGCTATTTAATC
CACTAAATGGTGGTCTGTAGACTCAATTCCGAGACGTCTTTCTCCCAAACTTGCACGACACTACTAGCCAAGATGATAGACACTGTACCGTCAAATGTCCATCTGAGCGATGTAGTCACC
CTCCTTCCGGTGAAAGTGTCCAACGCACAAATCACAGCGATCGATTCGCAGCTCGTTTTCATGACCGACCTCAGA
GTATTATCGTGTTTATCCGTGGTGAATATGTCAATGTTTAATCGA
CTTTTCTTCAGGTGGCCTTTCCGGCTGGCATTAGCCCTACGGCAGCGAGTAAAGTCCAGATGTTCTGGTGCGACAGTCGTGGCGTATTCAAAAATTGCAATCGGGTCACCAATGTTGCAT
CGCTCCCATTCCTGGATGAACCAAGCACGTCTCCTTTAACCGATTCTTTGAATATCCAGCTCGTTTTGTACAGATTCAAGGTCCAGATTTCAGCTTCTCGCTCTGTTTCCAAGTTCTGGT
TTGAAATTGACGGTGCTATTCACAACAATGGAGGCAATGGCTACCCAATAGGTCAAGACGAAATCATATTTGTGCCGTCGTTGGGGAGCGTGGACCCGAAATTCCTTCAACCTGACCCAG
CAAATCCATCTGAATTTTTGCCGAGGAACTATAACCTGGTATTTGGTGTAAGTGTTACCCCCTTGATCACCAATGAATTCATTCTGATTGTAATTTACTGCAGATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTATCACCGCTTCTTTCTGGATATTTTTTATACCGCTGTCAATAGTGATTTCATTTGTTTCAGCCGAGTATACCTGGCCGTCGGCACAGCACGACGCCCTCGAACAGTTTCTATAC
GAAGGCACCCATGTAACCGGTGACAATGTCGCCGGTTTGGCACGTTTCTGCCTTCCCAGATTTCTCCCTGGAGGAGACCAGCCATCTTCAGTCGCGGCCGAGTGGGTACGCCTG
GCATAC
CATGATATGGCTACTCATAATGCAACTGACGGTACAGGCGGGCTAGATGGTTCTATATTCTACGAACTTGACAGACCAGAG
AACGTCGGTGCCGGAAACGTCAACACGGTCGGGGATTTC
AAGGACCATTCAAGCAAACTCGTATCTA
GATCCGATATTATTGCGATGGGTGCCGTCTGGGCCGTGGCAGCATGTGGTGGTCCTCCGATACCATTCCGATATGGGAGGAAAGACGCCTTG
AAAGCAGGACGATCTGGAGTTCCAGAGCCACAGCAAAATCTTGCCAGCCACATAGAAAGCTTCCGCCTTCAAGGATTCACACAAAAAGAAATGATTGGACTTGTCGCATGCGGACATACC
CTTGGAGGAGTTCGGGGCGTTGACTTTCAGGACATCGTGCCTGATCCATCGATTTCTAGTATCGCGACGTTCGATACCACGTCCGGCCTCGACTCAGCCTTTGATCACCTTAT
TGTCACC
CAATACTTAAACTCCTCCACTCAAAACCCTTTGATCAGGGTGCCGTCAGGAAATTCAACGTTCGCATCAGATCTGCGAATATTTAGCAGCGACCAGAATGCCACCATGAAAGG
ACTCAAT
TCCGAGACGTCTTTCTCCCAAACTTGCACGACACTACTAGCCAAGATGATAGACACTGTACCGTCAAATGTCCATCTGAGCGATGTAGTCACCCTCCTTCCGGTGAAAGTGTCCAACGCA
CAAATCACAGCGATCGATTCGCAGCTCGTTTTCATGACCGACCTCAGA
GTGGCCTTTCCGGCTGGCATTAGCCCTACGGCAGCGAGTAAAGTCCAGATGTTCTGGTGCGACAGTCGTGGC
GTATTCAAAAATTGCAATCGGGTCACCAATGTTGCATCGCTCCCATTCCTGGATGAACCAAGCACGTCTCCTTTAACCGATTCTTTGAATATCCAGCTCGTTTTGTACAGATTCAAGGTC
CAGATTTCAGCTTCTCGCTCTGTTTCCAAGTTCTGGTTTGAAATTGACGGTGCTATTCACAACAATGGAGGCAATGGCTACCCAATAGGTCAAGACGAAATCATATTTGTGCCGTCGTTG
GGGAGCGTGGACCCGAAATTCCTTCAACCTGACCCAGCAAATCCATCTGAATTTTTGCCGAGGAACTATAACCTGGTATTTGGTGTAAGTGTTACCCCCTTGATCACCAATGAATTCATT
CTGATTGTAATTTACTGCAGATAA

Retrieve as FASTA