Entry information : GmarAPx-CcP08
Entry ID 11917
Creation 2013-05-27 (Christophe Dunand)
Last sequence changes 2013-05-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarAPx-CcP08
Name GmarAPx-CcP08
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarAPx-CcP08
start..stop
S start..stop
GmarAPx-CcP01 704 0 33..410 99..476
GmarAPx-CcP06 652 0 33..410 98..479
GmarAPx-CcP02 555 0 6..402 65..470
GmarAPx-CcP03 415 2e-141 33..400 93..458
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 954919..955044 126 N° 2 955782..955848 67 N° 3 955904..956216 313 N° 4 956266..956385 120
N° 5 956441..956615 175 N° 6 956669..957100 432  
join(954919..955044,955782..955848,955904..956216,956266..956385,956441..956615, 956669..957100)


exon

Literature and cross-references GmarAPx-CcP08
DNA ref. JGI genome:   scaffold_10 (954919..957100)
Cluster/Prediction ref. JGI gene:   65949
Protein sequence: GmarAPx-CcP08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   410
PWM (Da):   %s   44622.81  
PI (pH):   %s   6.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVDEIPDPIELLSNPSRFLALVRLMIDSFNQKTLIYDYTRVLNVGAGNVNSIGDFKGHSSKLVSRSDIIAMGVIWGVAACGGPPIPFRYGRKDALKAGRSGVPEPQQDLASHIESFRLQGFTQKEMIALVACGHTLGGVRSVDFQDIVPDPSNASIATFDTTSGFDHLIVTQYLNSSTKNPLIRVPSGNSTFASDLRIFGSHRNATMKGLNSETSFSQTCTTLLAKMIDTVPSNVHLSDVVTLLPVKVSSAQITAIDSQLVFMADLVTFPIDINPMAVSKVRMLWCDSRGQFKNCNRVTNIASIPFLDAADTSPLTDSFNIQFALYRFKVQISASRSVSKFWFEIDGVVHNNGSNDYLIGQDEIIFVPSLGSVDVKFPQPDPANPSQFLPRTYNLVFGVSGFLLIADAF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). incorrect prediction from JGI (first exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGACGAAATACCTGACCCGATCGAACTTCTCAGTAATCCATCCCGTTTTCTCGCTCTAGTCAGGTTAATGATTGATTCGTTCAACCAGAAAACTTTGATATATGATTATACGCGT
GTACTG
GTACGTTATTTCTCTTCATTTCTTGACTAGACTCCTGATGGTTTTTTGTTTTCTATTGAGGAAGCTGAAAACCTTTGCTCACCCTGTCAAAACGGTAGAAGATTCGATTGATAC
CGCCCAATAAGCGTCGAAGCCGTCATTGGAGCTACATTTCTCTAGATCAAAGGCCGCGAATTCACTGGTGGCTCCTTCCTCGGCAACTCGTAAGAGGATTAAGCGAAGCAATACACCGGC
AGTGCGTTCCATGCGATGAATGTATTTTTTTATCGTTTTCATTCTGGCAACTCATATTGCGGGTGCTTTTAGCCTCGAGCTAGCGCGGACAGAGGGAGCAAGCATTTGGGTTGATCGCAT
TCTGTAACTCGCGTGCAGCTCGTGAAATTTTGGTTCTCGTCACGATGGAAAATAAGGTCATGGTCGTCGAACTCTTGAGGTGAATACGAGAACTGCTTTGACTTAAATTTAGGTTCGTAA
TACTACCCCCATTCATGCAATGTTCGACTTTCAAGAACAATTCTAGTCTTGTGCTGCGCCGTACTGACGTTAGAGTCGTAGTGTCTACGAGTACAATAAGGGCCTATCCACCAACTGGCA
CCGTATAGAACAATTCGGAACTGCGCAGTACTGGTCAGACTTTCAGGACTGGCTGCGCACGTCGCCTGAAGAAATTCGTTATCAAGCAGGGACCGCACACATTTACTCTAAAATCCTACT
CAATTTCTTTATGTACCTCACAGAATGTCGGTGCCGGAAACGTCAACTCGATTGGGGATTTCAAAGGCCATTCAAGCAAACTCGTATCTAGTAAGAGAACCCTTACCTTAAAGTCGTGCT
TAAAACCGAACTGTCAAATTCAAAGGATCCGATATCATTGCTATGGGCGTCATCTGGGGCGTCGCAGCATGCGGTGGGCCTCCGATACCTTTTCGATACGGAAGGAAAGACGCCTTGAAA
GCCGGAAGATCTGGGGTCCCAGAGCCACAACAAGATCTTGCTAGCCATATAGAAAGTTTCCGTCTTCAAGGATTCACGCAAAAAGAGATGATTGCACTAGTCGCATGCGGACATACTCTC
GGAGGCGTCAGGAGCGTTGACTTTCAAGATATCGTTCCTGATCCATCGAATGCCAGTATCGCGACGTTCGATACCACATCTGGCTTCGATCACCTCAT
GTACAAATTCCTGCCAAGAAAT
TCAGCTGATGCTAATCCACCGTTTTAGTGTCACACAATACTTAAACTCGTCCACTAAAAATCCGTTGATCAGGGTGCCGTCAGGAAATTCAACGTTCGCATCAGATCTGCGAATATTTGG
CAGCCACCGAAATGCCACCATGAAAGG
GTATGCCGGACCATACACCTATAATCTATTAAATTCACTAAACAGTGTATTGTAGACTTAATTCCGAGACGTCTTTCTCCCAAACTTGCACGA
CACTACTGGCCAAAATGATTGACACCGTGCCGTCAAATGTCCACCTGAGCGATGTAGTCACGCTCCTTCCGGTGAAAGTGTCCAGCGCACAAATCACAGCAATCGATTCACAGCTCGTTT
TTATGGCTGACCTCAGA
GTACTTTCGCGTTAACCCGGGCAAACCTGTCAACGTCTAATTGATCTTTTCAGGTGACCTTTCCGATTGACATTAATCCTATGGCAGTCAGTAAAGTCCGGAT
GTTGTGGTGCGACAGCCGTGGCCAATTCAAGAACTGTAATCGAGTCACCAATATTGCATCGATCCCATTCCTGGATGCAGCAGACACGTCTCCCTTAACCGATTCATTTAATATCCAGTT
CGCTTTGTACAGATTCAAGGTCCAGATTTCAGCCTCTCGATCTGTCTCGAAGTTCTGGTTTGAAATTGATGGTGTTGTCCACAACAATGGAAGCAACGACTACCTAATAGGTCAAGACGA
AATCATATTTGTGCCGTCGTTGGGGAGCGTGGACGTTAAATTCCCGCAACCTGATCCAGCAAATCCGTCTCAATTCTTGCCGAGGACGTATAACCTGGTTTTTGGGGTAAGCGGTTTCCT
CTTGATCGCCGATGCGTTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGACGAAATACCTGACCCGATCGAACTTCTCAGTAATCCATCCCGTTTTCTCGCTCTAGTCAGGTTAATGATTGATTCGTTCAACCAGAAAACTTTGATATATGATTATACGCGT
GTACTG
AATGTCGGTGCCGGAAACGTCAACTCGATTGGGGATTTCAAAGGCCATTCAAGCAAACTCGTATCTAGATCCGATATCATTGCTATGGGCGTCATCTGGGGCGTCGCAGCATGC
GGTGGGCCTCCGATACCTTTTCGATACGGAAGGAAAGACGCCTTGAAAGCCGGAAGATCTGGGGTCCCAGAGCCACAACAAGATCTTGCTAGCCATATAGAAAGTTTCCGTCTTCAAGGA
TTCACGCAAAAAGAGATGATTGCACTAGTCGCATGCGGACATACTCTCGGAGGCGTCAGGAGCGTTGACTTTCAAGATATCGTTCCTGATCCATCGAATGCCAGTATCGCGACGTTCGAT
ACCACATCTGGCTTCGATCACCTCAT
TGTCACACAATACTTAAACTCGTCCACTAAAAATCCGTTGATCAGGGTGCCGTCAGGAAATTCAACGTTCGCATCAGATCTGCGAATATTTGGC
AGCCACCGAAATGCCACCATGAAAGG
ACTTAATTCCGAGACGTCTTTCTCCCAAACTTGCACGACACTACTGGCCAAAATGATTGACACCGTGCCGTCAAATGTCCACCTGAGCGATGTA
GTCACGCTCCTTCCGGTGAAAGTGTCCAGCGCACAAATCACAGCAATCGATTCACAGCTCGTTTTTATGGCTGACCTCAGA
GTGACCTTTCCGATTGACATTAATCCTATGGCAGTCAGT
AAAGTCCGGATGTTGTGGTGCGACAGCCGTGGCCAATTCAAGAACTGTAATCGAGTCACCAATATTGCATCGATCCCATTCCTGGATGCAGCAGACACGTCTCCCTTAACCGATTCATTT
AATATCCAGTTCGCTTTGTACAGATTCAAGGTCCAGATTTCAGCCTCTCGATCTGTCTCGAAGTTCTGGTTTGAAATTGATGGTGTTGTCCACAACAATGGAAGCAACGACTACCTAATA
GGTCAAGACGAAATCATATTTGTGCCGTCGTTGGGGAGCGTGGACGTTAAATTCCCGCAACCTGATCCAGCAAATCCGTCTCAATTCTTGCCGAGGACGTATAACCTGGTTTTTGGGGTA
AGCGGTTTCCTCTTGATCGCCGATGCGTTCTGA

Retrieve as FASTA