Entry information : CtheCcP01
Entry ID 11925
Creation 2013-05-28 (Christophe Dunand)
Last sequence changes 2013-05-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-28 (Christophe Dunand)
Peroxidase information: CtheCcP01
Name CtheCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium thermophilum    [TaxId: 209285 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CtheCcP01
start..stop
S start..stop
TterCcP01 614 0 1..353 1..355
StheCcP 609 0 1..351 1..351
CgCcP 604 0 1..353 1..353
PanCcP01 582 0 1..351 1..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1534756..1535236 481 N° 2 1534318..1534691 374 N° 3 1534043..1534255 213  
complement(join(1534043..1534255,1534318..1534691,1534756..1535236))


exon

Literature and cross-references CtheCcP01
DNA ref. GenBank:   GL988045.1 (1535236..1534043)
Protein sequence: CtheCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355
PWM (Da):   %s   39542.72 Transmb domain:   %s   i44-66o
PI (pH):   %s   8.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATATRTFARALRTSARPALSAAPRIAFRQSGHRFYSSEPAKKGSSAWLWLTGAAAAAGGGAYFYLNGSTPVTPKVFEPKFEDYQAVYNEIANRLEEDENYDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPEADHGANAGLKAARDFLEPVKAKFPWISYSDLWIIGGICAIQEMMGPKIPFRPGRQDKDVSACTPDGRLPDAAQGQDHLRNIFYRMGFNDQEIVALAGAHALGRCHPDRSGYSGPWTFSPTVLTNDYFKLLLEEKWQWKKWNGPKYEDKKTKSLMMLPADMSLVQDKEFKKWVQKYAADNDLFFKDFAAVITKLFELGVPFKEDTPTYVFKSTRE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCGCAACTCGTACTTTCGCCCGCGCTCTGCGCACCTCGGCCCGCCCCGCCCTTAGCGCTGCCCCTCGCATTGCCTTCCGTCAGAGCGGCCACCGCTTCTACTCATCTGAACCT
GCGAAGAAGGGCTCGTCTGCCTGGCTTTGGCTCACTGGTGCTGCCGCTGCTGCCGGCGGCGGTGCCTACTTCTACCTGAACGGCTCGACCCCTGTCACTCCTAAGGTTTTTGAGCCCAAG
TTCGAGGACTACCAGGCTGTTTACAACGAGATCGCCAACCGCCTGGAGGAGGATGAAAACTACGATGATGGCAGCTACGGCCCCGTCCTTCTCCGCCTTGCCTGGCACGCCAGCGGCACC
TACGATAAGGAGACTGGTACCGGCGGCAGCAACGGCGCCACTATGCGCTTCTCTCCCGAGGCTGACCACGGCGCCAATGCTGGTCTGAAGGCTGCCCGTGACTTCCTTGAGCCCGTCAAG
G
GTAAGCTTTCCTCGACCGTCTAAAGTGGTCAAAGTTGAAGACCTTGACTGACTTTCCTTGATAGCCAAATTCCCCTGGATCTCCTACTCTGACCTCTGGATCATCGGTGGTATCTGCGC
TATCCAGGAAATGATGGGCCCCAAGATCCCCTTCCGCCCTGGTCGCCAGGATAAGGATGTCTCCGCCTGCACTCCTGATGGCCGTCTCCCCGATGCTGCTCAGGGCCAGGACCACCTCCG
CAACATCTTCTACCGCATGGGCTTCAACGATCAGGAGATCGTTGCCCTTGCTGGTGCCCACGCTTTGGGCCGCTGCCACCCCGACCGCTCCGGCTACTCTGGCCCCTGGACCTTCTCTCC
TACTGTTCTGACCAACGACTACTTCAAGCTCCTGCTCGAAGAGAAGTGGCAGTGGAAGAAGTGGAACGGCCCCAAGCAG
GTTAGTTTTCATTCGAAACTTCTCCCGGGGCTAAAGGGCTA
TTGCTAACACAATAAACACAGTATGAGGACAAGAAGACTAAGTCCCTGATGATGCTCCCGGCCGATATGTCCCTCGTCCAGGACAAGGAGTTCAAGAAGTGGGTCCAGAAGTACGCTGCC
GACAATGACCTGTTCTTCAAGGACTTCGCTGCCGTCATCACCAAGCTCTTCGAGCTCGGTGTTCCCTTCAAGGAGGACACCCCTACCTATGTTTTCAAGTCGACCCGCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACCGCAACTCGTACTTTCGCCCGCGCTCTGCGCACCTCGGCCCGCCCCGCCCTTAGCGCTGCCCCTCGCATTGCCTTCCGTCAGAGCGGCCACCGCTTCTACTCATCTGAACCT
GCGAAGAAGGGCTCGTCTGCCTGGCTTTGGCTCACTGGTGCTGCCGCTGCTGCCGGCGGCGGTGCCTACTTCTACCTGAACGGCTCGACCCCTGTCACTCCTAAGGTTTTTGAGCCCAAG
TTCGAGGACTACCAGGCTGTTTACAACGAGATCGCCAACCGCCTGGAGGAGGATGAAAACTACGATGATGGCAGCTACGGCCCCGTCCTTCTCCGCCTTGCCTGGCACGCCAGCGGCACC
TACGATAAGGAGACTGGTACCGGCGGCAGCAACGGCGCCACTATGCGCTTCTCTCCCGAGGCTGACCACGGCGCCAATGCTGGTCTGAAGGCTGCCCGTGACTTCCTTGAGCCCGTCAAG
G
CCAAATTCCCCTGGATCTCCTACTCTGACCTCTGGATCATCGGTGGTATCTGCGCTATCCAGGAAATGATGGGCCCCAAGATCCCCTTCCGCCCTGGTCGCCAGGATAAGGATGTCTCC
GCCTGCACTCCTGATGGCCGTCTCCCCGATGCTGCTCAGGGCCAGGACCACCTCCGCAACATCTTCTACCGCATGGGCTTCAACGATCAGGAGATCGTTGCCCTTGCTGGTGCCCACGCT
TTGGGCCGCTGCCACCCCGACCGCTCCGGCTACTCTGGCCCCTGGACCTTCTCTCCTACTGTTCTGACCAACGACTACTTCAAGCTCCTGCTCGAAGAGAAGTGGCAGTGGAAGAAGTGG
AACGGCCCCAAGCAG
TATGAGGACAAGAAGACTAAGTCCCTGATGATGCTCCCGGCCGATATGTCCCTCGTCCAGGACAAGGAGTTCAAGAAGTGGGTCCAGAAGTACGCTGCCGACAAT
GACCTGTTCTTCAAGGACTTCGCTGCCGTCATCACCAAGCTCTTCGAGCTCGGTGTTCCCTTCAAGGAGGACACCCCTACCTATGTTTTCAAGTCGACCCGCGAGTAA

Retrieve as FASTA