Entry information : HEC38CIIAA01
Entry ID 11932
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2013-05-28 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HEC38CIIAA01
Name HEC38CIIAA01
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. EC38    [TaxId: 1001937 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HEC38CIIAA01
start..stop
S start..stop
HCO27CIIAA01 682 0 1..358 1..354
HC14CIIAA01 477 3e-170 1..356 1..354
XhypCIIAA02 448 5e-159 1..355 1..351
CgloCIIAA04_ST23 352 1e-118 1..355 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 191863..192681 819 N° 2 191548..191701 154 N° 3 191382..191485 104  
complement(join(191382..191485,191548..191701,191863..192681))


exon

Literature and cross-references HEC38CIIAA01
DNA ref. JGI genome:   scaffold_13 (192681..191382)
Cluster/Prediction ref. JGI gene:   367045
Protein sequence: HEC38CIIAA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (341)
PWM (Da):   %s   38392.34 (36466.2)  
PI (pH):   %s   8.66 (8.18) Peptide Signal:   %s   cut: 18 range:18-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVSIFLLSITAPRALGYPGMGNTMAEIKSRGDFALGRRSTELLGDLKTINDHNLTPQGSTIKSILQGGSAIADSNTFNPPGKLTSNACKKSVLCIWYYIVQDMKSTFTDSSGCTDLGRGAIRQGFHDAATWNRTSAYGGADGSLLLSDELNRSDNLGLADIGSQTKTWYDKYKSYGIGMADLIQTAAMTATVCCPGGPRIRLFVGRKDDSRAGPKGLLPDQSQDAPALINLFAAKTFTSNDLVALVGAHTAATQKFVDPSRSGASQDTTPSVWDTTFYSETIAGDNKTILIFHSDKSISGYSATKDQFKTFAGSNGKSLWSPVILQAYAQAYFRMSLLGVNNLNNLTEITQVLPLPQ*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGTCTCTATTTTCTTGCTTAGCATCACTGCCCCTCGAGCTCTGGGTTACCCTGGCATGGGCAACACTATGGCTGAAATCAAATCCCGTGGAGACTTCGCTTTAGGACGCAGGTCT
ACAGAGCTGTTGGGAGATCTGAAGACTATAAATGATCATAACTTAACCCCTCAAGGGTCGACCATCAAGTCGATTCTTCAGGGCGGAAGCGCTATCGCGGATAGTAACACATTCAATCCG
CCGGGCAAACTTACGTCTAACGCATGCAAGAAAAGCGTTTTATGCATCTGGTACTACATAGTCCAAGATATGAAGAGCACTTTCACGGACAGCAGCGGCTGTACGGACCTGGGCCGTGGT
GCTATTCGTCAGGGGTTTCATGATGCAGCAACATGGAACAGAACCTCGGCATACGGTGGTGCTGACGGCTCTCTTTTACTAAGCGATGAGCTCAACCGCTCTGATAACCTGGGACTTGCA
GACATTGGGTCGCAGACTAAGACGTGGTACGACAAATACAAGAGCTACGGAATAGGTATGGCCGACCTGATCCAAACCGCTGCTATGACCGCAACTGTGTGTTGCCCGGGAGGACCTCGT
ATTCGACTCTTCGTTGGACGAAAAGACGATAGCCGCGCTGGTCCTAAAGGGTTGCTTCCAGACCAATCACAAGACGCCCCGGCCTTAATAAACCTCTTTGCCGCAAAGACATTCACATCA
AATGACCTAGTAGCCCTTGTTGGCGCTCACACCGCAGCGACACAGAAGTTTGTCGACCCTAGTCGAAGCGGTGCTTCCCAAGATACAACTCCCAGCGTC
GTGAGTAATATCCAGAGTTCT
TTATTTCCCCCCTGAGCCTATCTTGGGAGCTAGAGATTCCCAATCAAGGTGAATGAGGAATCATTACTCCCGAAGCATGCCTAAAATTCGTGAACTCGTTTCCTAGAAAGGTACCTGATT
ACTGATTCTTGATGTCGCAGTGGGACACCACCTTTTACTCAGAGACTATTGCCGGAGACAACAAAACAATATTGATATTCCATAGTGATAAGAGTATATCCGGTTACTCAGCTACTAAGG
ATCAGTTTAAGACGTTTGCTGGTTCAAATGGCAAATCTCTCTGGTCTCCCGTGA
GTTCACTCCCCCTTTCCTGATGTCAATATGAATTGTTTCGTACAGACACCTATACTAATAAGTTCT
CCAGGCTTATGCTCAGGCGTACTTCCGCATGAGTCTGCTAGGAGTTAACAACTTAAACAATCTCACTGAGATTACACAGGTTTTGCCCTTGCCACAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGTCTCTATTTTCTTGCTTAGCATCACTGCCCCTCGAGCTCTGGGTTACCCTGGCATGGGCAACACTATGGCTGAAATCAAATCCCGTGGAGACTTCGCTTTAGGACGCAGGTCT
ACAGAGCTGTTGGGAGATCTGAAGACTATAAATGATCATAACTTAACCCCTCAAGGGTCGACCATCAAGTCGATTCTTCAGGGCGGAAGCGCTATCGCGGATAGTAACACATTCAATCCG
CCGGGCAAACTTACGTCTAACGCATGCAAGAAAAGCGTTTTATGCATCTGGTACTACATAGTCCAAGATATGAAGAGCACTTTCACGGACAGCAGCGGCTGTACGGACCTGGGCCGTGGT
GCTATTCGTCAGGGGTTTCATGATGCAGCAACATGGAACAGAACCTCGGCATACGGTGGTGCTGACGGCTCTCTTTTACTAAGCGATGAGCTCAACCGCTCTGATAACCTGGGACTTGCA
GACATTGGGTCGCAGACTAAGACGTGGTACGACAAATACAAGAGCTACGGAATAGGTATGGCCGACCTGATCCAAACCGCTGCTATGACCGCAACTGTGTGTTGCCCGGGAGGACCTCGT
ATTCGACTCTTCGTTGGACGAAAAGACGATAGCCGCGCTGGTCCTAAAGGGTTGCTTCCAGACCAATCACAAGACGCCCCGGCCTTAATAAACCTCTTTGCCGCAAAGACATTCACATCA
AATGACCTAGTAGCCCTTGTTGGCGCTCACACCGCAGCGACACAGAAGTTTGTCGACCCTAGTCGAAGCGGTGCTTCCCAAGATACAACTCCCAGCGTC
TGGGACACCACCTTTTACTCA
GAGACTATTGCCGGAGACAACAAAACAATATTGATATTCCATAGTGATAAGAGTATATCCGGTTACTCAGCTACTAAGGATCAGTTTAAGACGTTTGCTGGTTCAAATGGCAAATCTCTC
TGGTCTCCCGTGA
TTCTCCAGGCTTATGCTCAGGCGTACTTCCGCATGAGTCTGCTAGGAGTTAACAACTTAAACAATCTCACTGAGATTACACAGGTTTTGCCCTTGCCACAATAA

Retrieve as FASTA