Entry information : HCO27CcP01
Entry ID 11938
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2013-05-28 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HCO27CcP01
Name HCO27CcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. CO27-5    [TaxId: 1001938 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HCO27CcP01
start..stop
S start..stop
HEC38CcP01 738 0 1..359 1..359
DescCcP01 633 0 10..359 1..357
HC14CcP01 628 0 1..359 1..358
XhypCcP01 573 0 1..359 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 154526..155018 493 N° 2 153871..154457 587  
complement(join(153871..154457,154526..155018))


exon

Literature and cross-references HCO27CcP01
DNA ref. JGI genome:   scaffold_68 (155018..153871)
Cluster/Prediction ref. JGI gene:   396684
Protein sequence: HCO27CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360
PWM (Da):   %s   39905  
PI (pH):   %s   8.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAPIVSRQLARATLRTTARNTFATSARQTFRQHGGRRFYSSESTKASSSSSLVYLAGAAVAGAAGYYFYTQGSSAGVKVINPTKEDYQKVYDEIAKLLEENDDYDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPEGDHGANAGLKIARDFLEPVKAKFPWISYSDLWIIGGIAAIQEMQGPTIPFRPGRQDRDAAACTPDGRLPDGAKGSDHLRNIFYRMGFNDQEIVALAGAHALGRCHPDRSGFDGPWTFSPTVLTNDYYRLLLEEKWQFKKWDGPKQYEDAKTKSLMMLPADYALIQDKAFRPWVEKYAKDNDLFFKDFAAAVTKLFELGVPFKQDTEKIIFKPRNA

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCCGATCGTATCTCGTCAGCTCGCTCGTGCGACTCTACGCACCACCGCCAGAAACACATTCGCAACTTCTGCAAGACAGACGTTCCGACAACATGGCGGCCGTCGCTTCTAC
TCGTCCGAATCCACCAAGGCCTCGAGCTCGTCCTCTCTGGTCTACTTAGCGGGTGCCGCCGTTGCTGGTGCCGCCGGTTACTATTTCTACACACAAGGCTCCTCGGCCGGCGTTAAGGTC
ATTAACCCCACTAAGGAGGACTACCAGAAGGTGTACGACGAGATTGCCAAGCTCCTGGAGGAGAACGACGACTATGATGATGGTAGCTACGGTCCGGTCCTCCTGCGTCTGGCATGGCAC
GCTAGCGGTACATACGATAAGGAGACCGGTACCGGTGGCAGCAATGGTGCTACTATGCGCTTCTCGCCCGAGGGTGACCACGGTGCGAACGCTGGCTTGAAGATTGCTCGGGATTTCCTT
GAGCCTGTGAAAG
GTGAGTCATGTGGCAATGTCTCGCCCTTGCATGGTTAAGACAAGCTTGGCTGACGCACATATTTTTAGCCAAGTTCCCGTGGATCAGCTACTCCGATCTTTGGATCA
TTGGTGGTATTGCTGCCATTCAGGAGATGCAGGGCCCCACTATCCCGTTCCGACCTGGTCGTCAGGACCGAGATGCTGCGGCTTGCACTCCTGATGGACGTCTCCCCGACGGAGCCAAGG
GTTCTGACCACCTCCGTAACATCTTCTACCGCATGGGCTTCAACGACCAAGAAATTGTTGCCCTTGCTGGTGCTCACGCCCTTGGACGATGCCACCCCGACCGAAGCGGCTTCGACGGAC
CGTGGACATTCTCCCCCACTGTTCTGACCAACGACTACTACCGCCTCCTCCTCGAGGAGAAGTGGCAGTTCAAGAAGTGGGACGGCCCCAAGCAGTATGAGGACGCCAAGACCAAGTCTC
TCATGATGCTGCCGGCAGACTACGCACTTATCCAGGACAAGGCTTTCAGACCCTGGGTGGAGAAATACGCCAAGGACAACGACCTGTTCTTCAAAGACTTCGCCGCGGCGGTTACCAAGC
TGTTCGAGCTCGGCGTTCCCTTCAAGCAGGACACTGAGAAGATCATCTTTAAGCCCCGCAACGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCCGATCGTATCTCGTCAGCTCGCTCGTGCGACTCTACGCACCACCGCCAGAAACACATTCGCAACTTCTGCAAGACAGACGTTCCGACAACATGGCGGCCGTCGCTTCTAC
TCGTCCGAATCCACCAAGGCCTCGAGCTCGTCCTCTCTGGTCTACTTAGCGGGTGCCGCCGTTGCTGGTGCCGCCGGTTACTATTTCTACACACAAGGCTCCTCGGCCGGCGTTAAGGTC
ATTAACCCCACTAAGGAGGACTACCAGAAGGTGTACGACGAGATTGCCAAGCTCCTGGAGGAGAACGACGACTATGATGATGGTAGCTACGGTCCGGTCCTCCTGCGTCTGGCATGGCAC
GCTAGCGGTACATACGATAAGGAGACCGGTACCGGTGGCAGCAATGGTGCTACTATGCGCTTCTCGCCCGAGGGTGACCACGGTGCGAACGCTGGCTTGAAGATTGCTCGGGATTTCCTT
GAGCCTGTGAAAG
CCAAGTTCCCGTGGATCAGCTACTCCGATCTTTGGATCATTGGTGGTATTGCTGCCATTCAGGAGATGCAGGGCCCCACTATCCCGTTCCGACCTGGTCGTCAGGAC
CGAGATGCTGCGGCTTGCACTCCTGATGGACGTCTCCCCGACGGAGCCAAGGGTTCTGACCACCTCCGTAACATCTTCTACCGCATGGGCTTCAACGACCAAGAAATTGTTGCCCTTGCT
GGTGCTCACGCCCTTGGACGATGCCACCCCGACCGAAGCGGCTTCGACGGACCGTGGACATTCTCCCCCACTGTTCTGACCAACGACTACTACCGCCTCCTCCTCGAGGAGAAGTGGCAG
TTCAAGAAGTGGGACGGCCCCAAGCAGTATGAGGACGCCAAGACCAAGTCTCTCATGATGCTGCCGGCAGACTACGCACTTATCCAGGACAAGGCTTTCAGACCCTGGGTGGAGAAATAC
GCCAAGGACAACGACCTGTTCTTCAAAGACTTCGCCGCGGCGGTTACCAAGCTGTTCGAGCTCGGCGTTCCCTTCAAGCAGGACACTGAGAAGATCATCTTTAAGCCCCGCAACGCTTAA

Retrieve as FASTA