Entry information : HCO27CIIAA01
Entry ID 11940
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2013-05-28 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HCO27CIIAA01
Name HCO27CIIAA01
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. CO27-5    [TaxId: 1001938 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HCO27CIIAA01
start..stop
S start..stop
HEC38CIIAA01 682 0 1..354 1..358
HC14CIIAA01 488 1e-174 1..352 1..354
XhypCIIAA02 455 1e-161 1..351 1..351
CgloCIIAA04_ST23 356 2e-120 1..351 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19854..20672 819 N° 2 20838..20987 150 N° 3 21063..21158 96  
join(19854..20672,20838..20987,21063..21158)


exon

Literature and cross-references HCO27CIIAA01
DNA ref. JGI genome:   scaffold_20 (19854..21158)
Cluster/Prediction ref. JGI gene:   379237
Protein sequence: HCO27CIIAA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (337)
PWM (Da):   %s   37978.02 (36033.9)  
PI (pH):   %s   8.18 (7.86) Peptide Signal:   %s   cut: 18 range:18-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKISIFLLSIITSQALGYPGMGNTMAEIKSRGDFALGRRSTELLGDLKTINDHDLTSQGSTIKSILQGGSAIADSNTFNPPGKLTSNACKKSVLCIWYYIVQDMKSTFTDSSGCTDLGRGAIRQGFHDAATWNRTSTYGGADGSLLLSDELNRSDNLGLADIGSQTKTWYDKYKSYGIGMADLIQTAAMTATVCCPGGPRIRLFVGRKDDSRAGPKGLLPDQSQDAPALINLFAAKTFTSNDLVALVGAHTAATQKFVDPSRSGASQDTTPSVWDTTFYSETIAGDNKTILIFHSDKSISGYSATKDQFKTFAGSNGKSLWSPAYAQAYFRMSLLGVNNLNNLTEITQVLPLPQ*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATCTCTATTTTCTTGCTTAGCATCATTACCTCTCAAGCTCTGGGTTACCCTGGCATGGGCAACACTATGGCTGAAATCAAATCCCGCGGAGACTTCGCTCTAGGACGCAGGTCT
ACAGAGCTGTTGGGAGATCTGAAGACTATCAATGATCATGACTTAACCTCTCAAGGGTCGACCATCAAGTCTATTCTTCAAGGTGGAAGCGCTATTGCGGATAGTAACACATTCAATCCC
CCTGGCAAACTTACGTCCAACGCATGCAAGAAAAGCGTTTTATGCATCTGGTACTACATAGTCCAAGATATGAAGAGCACATTCACGGACAGCAGCGGCTGTACGGACCTGGGCCGTGGT
GCTATCCGTCAGGGGTTTCATGATGCAGCAACATGGAACAGAACCTCGACATACGGTGGTGCTGACGGCTCTCTTTTACTAAGCGATGAGCTCAATCGCTCTGATAACCTGGGACTTGCA
GACATTGGGTCGCAGACTAAGACGTGGTACGACAAATACAAAAGCTACGGAATAGGTATGGCCGACCTGATCCAAACCGCTGCTATGACCGCGACTGTGTGTTGCCCGGGAGGACCTCGT
ATTCGACTCTTCGTTGGACGAAAAGACGATAGCCGCGCTGGTCCTAAAGGGTTGCTTCCAGACCAATCACAAGACGCTCCGGCCTTAATCAACCTCTTTGCCGCAAAGACATTCACATCT
AATGACCTAGTAGCCCTTGTTGGCGCTCACACCGCAGCGACGCAGAAGTTTGTCGACCCCAGTCGAAGCGGTGCTTCCCAAGATACAACTCCCAGCGTC
GTGAGTAATATCTAAAGTTCT
TTATTTGCCCCTTGAGCCTATCTTGGGAGCTAGAGATTCCTAATCAAGGTGAACGAGGAACCATTGCTCCCGAAACATGCCTACCTAAAATTCGTGAACCTGTTTCCTAGAAAGGTACCT
GATTACTGATTCTTGAGGTCGCAGTGGGACACCACCTTTTACTCAGAGACTATTGCCGGAGACAACAAAACAATCTTGATATTCCATAGTGATAAGAGTATATCCGGTTACTCAGCTACC
AAGGATCAGTTTAAGACGTTTGCTGGTTCAAATGGCAAATCTCTCTGGTCTCCT
GTGAGTTCACTCCCCCTTTTCCTGATGTCAATATGAACTGTTTCGTACAGATACCTATACTAATAA
GTTCTCCAGGCTTATGCACAGGCGTACTTCCGCATGAGCCTGCTGGGAGTTAACAACTTAAACAATCTCACTGAGATTACACAGGTTTTGCCCTTGCCACAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATCTCTATTTTCTTGCTTAGCATCATTACCTCTCAAGCTCTGGGTTACCCTGGCATGGGCAACACTATGGCTGAAATCAAATCCCGCGGAGACTTCGCTCTAGGACGCAGGTCT
ACAGAGCTGTTGGGAGATCTGAAGACTATCAATGATCATGACTTAACCTCTCAAGGGTCGACCATCAAGTCTATTCTTCAAGGTGGAAGCGCTATTGCGGATAGTAACACATTCAATCCC
CCTGGCAAACTTACGTCCAACGCATGCAAGAAAAGCGTTTTATGCATCTGGTACTACATAGTCCAAGATATGAAGAGCACATTCACGGACAGCAGCGGCTGTACGGACCTGGGCCGTGGT
GCTATCCGTCAGGGGTTTCATGATGCAGCAACATGGAACAGAACCTCGACATACGGTGGTGCTGACGGCTCTCTTTTACTAAGCGATGAGCTCAATCGCTCTGATAACCTGGGACTTGCA
GACATTGGGTCGCAGACTAAGACGTGGTACGACAAATACAAAAGCTACGGAATAGGTATGGCCGACCTGATCCAAACCGCTGCTATGACCGCGACTGTGTGTTGCCCGGGAGGACCTCGT
ATTCGACTCTTCGTTGGACGAAAAGACGATAGCCGCGCTGGTCCTAAAGGGTTGCTTCCAGACCAATCACAAGACGCTCCGGCCTTAATCAACCTCTTTGCCGCAAAGACATTCACATCT
AATGACCTAGTAGCCCTTGTTGGCGCTCACACCGCAGCGACGCAGAAGTTTGTCGACCCCAGTCGAAGCGGTGCTTCCCAAGATACAACTCCCAGCGTC
TGGGACACCACCTTTTACTCA
GAGACTATTGCCGGAGACAACAAAACAATCTTGATATTCCATAGTGATAAGAGTATATCCGGTTACTCAGCTACCAAGGATCAGTTTAAGACGTTTGCTGGTTCAAATGGCAAATCTCTC
TGGTCTCCT
GCTTATGCACAGGCGTACTTCCGCATGAGCCTGCTGGGAGTTAACAACTTAAACAATCTCACTGAGATTACACAGGTTTTGCCCTTGCCACAATAA

Retrieve as FASTA