Entry information : TharCP01
Entry ID 11964
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-24 (Catherine Mathe (Scipio))
Peroxidase information: TharCP01
Name TharCP01
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Hypocreaceae Hypocrea
Organism Trichoderma harzianum    [TaxId: 5544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TharCP01
start..stop
S start..stop
TviCP01 1373 0 1..761 1..758
TatCP01 1348 0 1..759 1..757
TaspCP02 1313 0 1..759 1..758
HjCP01 1304 0 6..761 5..759
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 314586..314915 330 N° 2 314991..315371 381 N° 3 315447..317021 1575  
join(314586..314915,314991..315371,315447..317021)


exon

Literature and cross-references TharCP01
DNA ref. JGI genome:   scaffold_6 (314586..317021)
Cluster/Prediction ref. JGI gene:   5187
Protein sequence: TharCP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   762
PWM (Da):   %s   83168.84  
PI (pH):   %s   6.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGDAGKCPVNHVNAAGGGTRNKDWWPESLKLNILRQHTNVTNPLGADFDYPTAFKSLDYAAVKKDLTALMTDSQDWWPADFGHYGGLFVRLAWHSAGTYRVFDGRGGGGQGQQRFAPLNSWPDNVSLDKGRRLLWPIKQKYGNKLSWADLFILSGNVALESMGFKTLGFAGGRSDTWEADESVYWGGETTWLGNDVRYSHGFAGPNDPAGAGHGVLISDEKKHKDIHSRDLESPLGAVHMGLIYVNPEGPDGSADILAAARDIRVTFARMAMNDEETVALIAGGHTFGKTHGAGPASHVGTEPAGAPLENQGLGWVSSFNSGKGPDAITSGLEVTWTKTPTQWSNQFFEYLFKFEWELTTSPAGAKQWVAKNADPIIPHAFDSSKKLLPTMLTTDLALRFDPEYEKISRRFLENQDQFAEAFAKAWFKLTHRDMGPLSRYVGPEVPKEEFSWQDPIPAVNYTLINDSDIATLKSQILASGVSPSKLVSTAWASASTFRGSDKRGGANGARIRLSPQKDWKVNNPPQLAEVLQALEKIQQNFNGSQSGKKVSLADLIVLAGAAAIEKAAKDAGHNITVPFTPGRNDATQEQTDVESVGHLEPFADGFRNYGKSTPRVKLEHFLVDRAHLLTLSVPELTVLVGGLRVLGTNFDGSTHGVFTNRPGTLTNDFFVNLLDMGTVWKANPSDGDLFEGSDRKSGAKKWTGTRVDLVFGHHPELRAVSEVYGSSDASQKFVNDFVTAWTKVSNLDRFDLKESDSRPRL*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGACGCCGGCAAGTGTCCTGTGAACCACGTCAACGCCGCGGGCGGCGGAACCAGAAACAAGGATTGGTGGCCCGAGTCTCTCAAGCTCAACATTCTTCGCCAGCACACAAATGTG
ACGAACCCCCTTGGAGCCGACTTTGACTATCCCACTGCTTTCAAGTCTCTTGACTATGCTGCTGTCAAGAAGGACCTCACAGCTCTTATGACTGATTCCCAAGACTGGTGGCCCGCTGAT
TTCGGTCACTACGGAGGTCTGTTTGTTCGTCTGGCGTGGCACAGCGCTGGTACATACCGTGTCTTTGATGGTCGCGGTGGTGGTGGCCAG
GTAAGCACCCTTGAATGTTATTATTTCGAC
CAACACTTTGGACATATGTAGCTGACCTGATTTTCCATGTAACAGGGCCAACAACGATTCGCACCACTTAACAGCTGGCCGGACAACGTGAGCTTGGACAAAGGCCGTCGTCTGCTGTGG
CCCATCAAGCAAAAGTATGGCAACAAGCTCTCATGGGCCGATCTCTTCATCTTGTCCGGCAACGTTGCTCTCGAGTCCATGGGATTCAAGACGCTTGGTTTTGCCGGTGGCCGTTCAGAC
ACCTGGGAAGCCGATGAGTCTGTCTACTGGGGTGGCGAAACCACATGGCTCGGCAACGATGTTCGATATTCCCACGGTTTTGCAGGCCCTAATGACCCTGCCGGCGCAGGCCACGGCGTC
CTCATCTCCGACGAAAAGAAGCACAAAGATATCCACTCTCGCGACCTGGAGTCTCCCCTCGGTGCT
GTATGTTTTCTCTTCTTTTATTTCTATCTGGGTTTAGCCACAGAAAACATTTAG
CTGACGATACAACGCGTATAGGTACACATGGGTCTGATTTACGTCAACCCAGAGGGCCCTGATGGTAGTGCCGATATTTTGGCTGCCGCTCGGGACATCCGTGTCACTTTTGCCCGCATG
GCCATGAATGATGAGGAGACTGTCGCTCTTATTGCTGGTGGCCACACCTTCGGTAAGACTCACGGTGCCGGTCCTGCAAGCCATGTTGGCACTGAGCCCGCCGGTGCTCCGCTCGAGAAC
CAAGGTCTCGGCTGGGTCAGCTCCTTCAACTCTGGAAAGGGTCCTGATGCCATTACCAGTGGTCTTGAGGTTACCTGGACCAAGACACCAACTCAGTGGAGCAACCAGTTCTTCGAGTAC
CTCTTCAAGTTTGAATGGGAGCTCACCACAAGCCCTGCCGGTGCCAAGCAGTGGGTTGCTAAGAACGCTGATCCCATCATTCCCCACGCTTTTGATTCTTCCAAGAAGCTGCTACCTACC
ATGTTGACCACGGATCTGGCTCTGCGCTTTGACCCTGAGTACGAGAAGATCTCTCGCCGTTTCTTGGAGAACCAAGATCAGTTCGCTGAAGCTTTTGCCAAGGCTTGGTTCAAGCTGACG
CACCGTGACATGGGACCTCTCAGCCGATACGTTGGCCCTGAAGTCCCCAAGGAGGAATTCTCCTGGCAAGATCCCATCCCCGCTGTCAACTACACTCTCATCAACGACAGCGACATTGCC
ACGCTCAAGAGCCAGATCTTGGCATCCGGCGTGTCACCATCCAAGCTTGTTTCCACCGCATGGGCTTCTGCCTCGACCTTCCGAGGTAGCGACAAGCGTGGTGGTGCCAATGGTGCTCGT
ATCCGCCTGTCACCCCAAAAGGACTGGAAGGTGAACAACCCTCCTCAGCTGGCCGAGGTTCTGCAGGCTCTGGAAAAGATTCAGCAGAACTTCAACGGCTCTCAGAGCGGCAAGAAGGTT
TCTCTTGCTGACCTGATTGTCCTGGCGGGAGCTGCTGCTATTGAGAAGGCTGCCAAGGATGCAGGACACAACATCACTGTCCCCTTTACTCCTGGTCGTAACGACGCTACTCAGGAGCAG
ACTGATGTCGAGTCAGTTGGCCACCTCGAGCCCTTTGCTGATGGCTTCCGCAACTACGGCAAGTCGACTCCAAGAGTCAAGCTGGAGCACTTCCTCGTTGACAGGGCACACCTTCTGACC
CTCTCTGTTCCCGAGCTGACCGTTCTTGTTGGTGGTCTACGTGTTCTGGGTACCAACTTTGACGGATCAACTCACGGTGTCTTCACCAACCGTCCCGGAACTCTGACCAACGACTTCTTT
GTCAACCTCCTGGACATGGGAACCGTCTGGAAGGCCAACCCCTCTGACGGCGACCTCTTCGAGGGCAGCGACCGCAAGAGCGGTGCCAAGAAGTGGACTGGTACCCGTGTTGACCTTGTC
TTCGGCCATCACCCCGAGCTGCGTGCCGTCTCCGAGGTCTACGGCAGCTCTGATGCCAGCCAGAAGTTTGTCAACGACTTCGTCACTGCTTGGACAAAGGTCTCCAACCTGGATCGCTTT
GACCTTAAGGAGTCTGACTCAAGACCCCGCTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGACGCCGGCAAGTGTCCTGTGAACCACGTCAACGCCGCGGGCGGCGGAACCAGAAACAAGGATTGGTGGCCCGAGTCTCTCAAGCTCAACATTCTTCGCCAGCACACAAATGTG
ACGAACCCCCTTGGAGCCGACTTTGACTATCCCACTGCTTTCAAGTCTCTTGACTATGCTGCTGTCAAGAAGGACCTCACAGCTCTTATGACTGATTCCCAAGACTGGTGGCCCGCTGAT
TTCGGTCACTACGGAGGTCTGTTTGTTCGTCTGGCGTGGCACAGCGCTGGTACATACCGTGTCTTTGATGGTCGCGGTGGTGGTGGCCAG
GGCCAACAACGATTCGCACCACTTAACAGC
TGGCCGGACAACGTGAGCTTGGACAAAGGCCGTCGTCTGCTGTGGCCCATCAAGCAAAAGTATGGCAACAAGCTCTCATGGGCCGATCTCTTCATCTTGTCCGGCAACGTTGCTCTCGAG
TCCATGGGATTCAAGACGCTTGGTTTTGCCGGTGGCCGTTCAGACACCTGGGAAGCCGATGAGTCTGTCTACTGGGGTGGCGAAACCACATGGCTCGGCAACGATGTTCGATATTCCCAC
GGTTTTGCAGGCCCTAATGACCCTGCCGGCGCAGGCCACGGCGTCCTCATCTCCGACGAAAAGAAGCACAAAGATATCCACTCTCGCGACCTGGAGTCTCCCCTCGGTGCT
GTACACATG
GGTCTGATTTACGTCAACCCAGAGGGCCCTGATGGTAGTGCCGATATTTTGGCTGCCGCTCGGGACATCCGTGTCACTTTTGCCCGCATGGCCATGAATGATGAGGAGACTGTCGCTCTT
ATTGCTGGTGGCCACACCTTCGGTAAGACTCACGGTGCCGGTCCTGCAAGCCATGTTGGCACTGAGCCCGCCGGTGCTCCGCTCGAGAACCAAGGTCTCGGCTGGGTCAGCTCCTTCAAC
TCTGGAAAGGGTCCTGATGCCATTACCAGTGGTCTTGAGGTTACCTGGACCAAGACACCAACTCAGTGGAGCAACCAGTTCTTCGAGTACCTCTTCAAGTTTGAATGGGAGCTCACCACA
AGCCCTGCCGGTGCCAAGCAGTGGGTTGCTAAGAACGCTGATCCCATCATTCCCCACGCTTTTGATTCTTCCAAGAAGCTGCTACCTACCATGTTGACCACGGATCTGGCTCTGCGCTTT
GACCCTGAGTACGAGAAGATCTCTCGCCGTTTCTTGGAGAACCAAGATCAGTTCGCTGAAGCTTTTGCCAAGGCTTGGTTCAAGCTGACGCACCGTGACATGGGACCTCTCAGCCGATAC
GTTGGCCCTGAAGTCCCCAAGGAGGAATTCTCCTGGCAAGATCCCATCCCCGCTGTCAACTACACTCTCATCAACGACAGCGACATTGCCACGCTCAAGAGCCAGATCTTGGCATCCGGC
GTGTCACCATCCAAGCTTGTTTCCACCGCATGGGCTTCTGCCTCGACCTTCCGAGGTAGCGACAAGCGTGGTGGTGCCAATGGTGCTCGTATCCGCCTGTCACCCCAAAAGGACTGGAAG
GTGAACAACCCTCCTCAGCTGGCCGAGGTTCTGCAGGCTCTGGAAAAGATTCAGCAGAACTTCAACGGCTCTCAGAGCGGCAAGAAGGTTTCTCTTGCTGACCTGATTGTCCTGGCGGGA
GCTGCTGCTATTGAGAAGGCTGCCAAGGATGCAGGACACAACATCACTGTCCCCTTTACTCCTGGTCGTAACGACGCTACTCAGGAGCAGACTGATGTCGAGTCAGTTGGCCACCTCGAG
CCCTTTGCTGATGGCTTCCGCAACTACGGCAAGTCGACTCCAAGAGTCAAGCTGGAGCACTTCCTCGTTGACAGGGCACACCTTCTGACCCTCTCTGTTCCCGAGCTGACCGTTCTTGTT
GGTGGTCTACGTGTTCTGGGTACCAACTTTGACGGATCAACTCACGGTGTCTTCACCAACCGTCCCGGAACTCTGACCAACGACTTCTTTGTCAACCTCCTGGACATGGGAACCGTCTGG
AAGGCCAACCCCTCTGACGGCGACCTCTTCGAGGGCAGCGACCGCAAGAGCGGTGCCAAGAAGTGGACTGGTACCCGTGTTGACCTTGTCTTCGGCCATCACCCCGAGCTGCGTGCCGTC
TCCGAGGTCTACGGCAGCTCTGATGCCAGCCAGAAGTTTGTCAACGACTTCGTCACTGCTTGGACAAAGGTCTCCAACCTGGATCGCTTTGACCTTAAGGAGTCTGACTCAAGACCCCGC
TTGTAA

Retrieve as FASTA