Entry information : TharGPx01
Entry ID 11972
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-24 (Catherine Mathe (Scipio))
Peroxidase information: TharGPx01
Name TharGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Hypocreaceae Hypocrea
Organism Trichoderma harzianum    [TaxId: 5544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TharGPx01
start..stop
S start..stop
TviGPx01 350 8e-125 1..170 86..255
HjGPx01 317 2e-111 1..170 94..263
TatGPx01 316 2e-111 1..170 93..262
TaspGPx01 315 6e-111 1..170 94..263
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1993260..1993302 43 N° 2 1992622..1993091 470  
complement(join(1992622..1993091,1993260..1993302))


exon

Literature and cross-references TharGPx01
DNA ref. JGI genome:   scaffold_3 (1993302..1992622)
Cluster/Prediction ref. JGI gene:   505524
Protein sequence: TharGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19312.76  
PI (pH):   %s   5.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATNFFDFTVLDAADTEVPLANYKGKVVLVVNTASKCGFTYQYKNLESVYQALKKEYPDDFTVIGFPCNQFGGQEPGSNEEIQNFCSLEQKTTFPVMAKINVNGNDAHPLYQWLKKEKPGLLGLERIKWNFEKFLIGRDGKVIDRWASTTEPEKFQNKIVEAIKAPAP

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGCTACCAACTTCTTCGACTTCACGGTGCTCGACGGTAAGCTTTCGACATTTTCCCTCCAAAGCCCCTCCATTCCCATCCATCGCCCGCACGCATCTAAGCCGATAGCTACC
GCCCCGCTATTGCGCCAGATTACGATCGATCTGCTTACAAGCCCGTTGAACAACTTTTCCCGCTAACGAGTGTGCCTTTTTTTTCTTACAGCCGCCGACACCGAAGTCCCTCTGGCCAAC
TACAAGGGCAAGGTCGTCTTGGTCGTCAACACGGCGTCCAAGTGCGGCTTCACCTACCAGTACAAGAACCTCGAGTCCGTCTACCAGGCCCTCAAGAAGGAGTACCCCGACGACTTCACC
GTCATCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGGCAGCAACGAGGAGATCCAGAACTTTTGCTCGCTGGAGCAGAAGACGACGTTCCCCGTCATGGCCAAGATCAACGTC
AACGGCAACGATGCGCACCCCCTGTATCAGTGGCTGAAGAAGGAGAAGCCTGGTCTGCTTGGTCTCGAGAGGATCAAGTGGAACTTTGAGAAGTTCTTGATCGGCCGTGACGGCAAGGTT
ATCGACCGCTGGGCCAGCACTACCGAGCCCGAGAAGTTCCAGAACAAGATCGTTGAGGCCATCAAGGCGCCCGCCCCTCAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGCTACCAACTTCTTCGACTTCACGGTGCTCGACGCCGCCGACACCGAAGTCCCTCTGGCCAACTACAAGGGCAAGGTCGTCTTGGTCGTCAACACGGCGTCCAAGTGCGGC
TTCACCTACCAGTACAAGAACCTCGAGTCCGTCTACCAGGCCCTCAAGAAGGAGTACCCCGACGACTTCACCGTCATCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGGCAGC
AACGAGGAGATCCAGAACTTTTGCTCGCTGGAGCAGAAGACGACGTTCCCCGTCATGGCCAAGATCAACGTCAACGGCAACGATGCGCACCCCCTGTATCAGTGGCTGAAGAAGGAGAAG
CCTGGTCTGCTTGGTCTCGAGAGGATCAAGTGGAACTTTGAGAAGTTCTTGATCGGCCGTGACGGCAAGGTTATCGACCGCTGGGCCAGCACTACCGAGCCCGAGAAGTTCCAGAACAAG
ATCGTTGAGGCCATCAAGGCGCCCGCCCCTCAA

Retrieve as FASTA