Entry information : AtPrx27 (At3g01190 / PER27 / AtperoxP27 / PRXR7 / ATP12 / Atp12a / Atprxr7ge)
Entry ID 120
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx27 (At3g01190 / PER27 / AtperoxP27 / PRXR7 / ATP12 / Atp12a / Atprxr7ge)
Name (synonym) AtPrx27 (At3g01190 / PER27 / AtperoxP27 / PRXR7 / ATP12 / Atp12a / Atprxr7ge)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Cell culture
Flowers
Mixed tissues
Roots
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx27
start..stop
S start..stop
AhalPrx60 637 0 1..321 1..321
AlyPrx27 636 0 1..321 1..321
CrubPrx100 619 0 1..318 1..318
CagraPrx37 616 0 1..321 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 68265..68477 213 N° 2 67984..68169 186 N° 3 67726..67885 160 N° 4 67236..67642 407
complement(join(67236..67642,67726..67885,67984..68169,68265..68477))


exon

Literature and cross-references AtPrx27 (At3g01190 / PER27 / AtperoxP27 / PRXR7 / ATP12 / Atp12a / Atprxr7ge)
Protein ref. UniProtKB:   Q43735
DNA ref. Phytozome 12:   Chr3 (68477..67236)
mRNA ref. GenBank:   NM_110985
Cluster/Prediction ref. Phytozome Gene 12:   19662747 UniGene:   At.22518
Omic ref. AtProteome:   At3g01190 ATTED-II:   At3g01190 e-FP Browser:   At3g01190 ePlant:   At3g01190 Genevestigator:   At3g01190 TAIR:   At3g01190
Protein sequence: AtPrx27 (At3g01190 / PER27 / AtperoxP27 / PRXR7 / ATP12 / Atp12a / Atprxr7ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   34813.91 (32351.6)  
PI (pH):   %s   9.3 (9.09) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASKRLVVSCLFLVLLFAQANSQGLKVGFYSKTCPQLEGIVKKVVFDAMNKAPTLGAPLLRMFFHDCFVRGCDGSVLLDKPNNQGEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPSWEVETGRRDGRVSNINEVNLPSPFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKCKPTDTTTALEMDPGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFFNDFGVSMVKMGRTGVLTGKAGEIRKTCRSAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 9 cDNA and 31 ESTs. Mainly in roots.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATGATGCAT ATTTCAAAAG GATTGAAGCC ATTGAGTTTA CCATTAAGCA AGATGATGGG ACTTTACCTG AGAACTTAAG CAAGGCTGAT ATAGTTCTTG TCGGGGTTTC CCGGACAGGG  AAGACGCCCT TGTCCACTTA CATTGCTCAA AAAGGGTACA AAGTTGCTAA TGTGCCGTTT GTGATGGGCG TGGAACCACC CAGGACGCTC TTTCAGGTTG AACCGAGAAA AGTTTTTGGT  TTGAAGATCC AGCTCGTTGT ACTGCAAGCG ATTAGAAGAA CAAGGGTTAA AACGCTAGGC GTAGATACAG AGGCAGAGAA CAATTACTCG GGGATTGATC TTGTTCGGAA AGAACTAGAT  TTCGCGTCAA GGATCTATGA GCGAAACCCC GGATGGGCAG TGATAGGTAA ACAAAACTTA AACACCATTC TCATTTGCTA CTCAAAATGC TGTTTTTTTC TTTCCTTTTA ATGCTAGTAA  GAAAAAAAGT TAACAAGTAG GCAGAGTATT CTCATGTGTT ATTCTTGGGG TTGTGGCGCT TGCAGATGTG ACGAATAAGG CGATTGAAGA AACCGCGGCT GTGATTCTGC GGCTGTACCA  TGACGGTAGA GACACTAGTA CTACGGTACC GCGTATCTCA AAACGCTACT AAGCACACTC CTTTGACCGT AGAGAGGATG AAACACCAGT GTCGATAAAG TATCAAGTGA ATAAAGTAAT  ATATGTCTAT AATAATAAGT TGAATAACAA ATCCAACCGA GGCATGATGA ATCATATGTT TTAGTCAACG AATGTAAGAG GATGAAGGAT AACGAAAACT AATAATTGTG GCTACTCTGA  ATTCTTTTAT TACTAGTCTA TAAAACAAAA GAATATCTGT CATTAGCATT TAGTTGCAAC GTTGCAATTT GGGTGTGTTT AGCAAGTTCA AGAAAAGTCA TCCAAAACTT AATGTCATTT  TAGTTAATCT ATTTTGACTC TTTCTATTCG TTTATGAATG AATATTTCGG TAATTACCAA AAAATCTTCT GATTATCCAA AGTAGATGAT CAGAGATTTG TGTCCATCTT CGATTTATAT  AACTAATTAG TGATATTTTC TTCCTGTAAG TAAACGATGA ACCTGGAAAC ATGCAAGGTT TTTTCGACTG TCAATTTATG TGGATGATTA TTGCTATTCA ATCTGTTCAT CCACATGATT  AATAAGATGC TAATTGGTAA CACATGGCGT AGTTTAGAAA AGGTTAAAAC GTTGCGGTCA AATGATTGAC GTAATTGGAA GAACATGCAC GAAACATTAC AGGAAACCTA TAATGCATGG  ATGCATGTGG GATCAAATAA TTGTTATCGA TAACGTCCAA GTATCAATTG ATATGCATAT ATGTAGATAT TTTAATCTAC TTGATAAGAT AAAAACTTAA TTTTAATTTA AGTTATTCTT  CCAACTGTTG TTGGCAAAGT ATTGTCCCAC TCTATAAGGC AAGTAATACA AAATACATTG TTTTAACTAT ATCCGAACTC TATATGTCTT TTTCTTGTTA AGTAGAGGAA CTAGAGGTGT  CTTAGTGACG TGAGACACAC GAAATTTTCA ATTCTTAAAA CCCCATTTGT ATTTAATTTG GGCTTAAAGA AATTTAGGCA GCCATTTTTT TTGGTGGTAG CAATATACAC CATGCATAAG  ACAACATCGA CACAAATATT ATATACACAT ATATATAGTA CGACTTGTAT CAATTTGCCT CTTCTTATTT CTACAAACAA TGATTGGTCT TAAGAACAAC AAAAATACAA CAAGCATTCC  ACCGCAGACC AATGATAGTC AACTACATTT TGATGTTAAT TAATCTCAAT CTTCTAACCA CAAACTCTTA TAATATTGCA AGTTAGTTTA AACTACTTAC ATAATTGAGT ATAAAATAGC 
TTCAACCTTC ATCAACAATT CATTATCAAT CGAGCAAAAA ACAAAAGCTA AGAGCAACAA ACTAAAGATT TTTTAAGAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGATATAGA AATGAAAATA TCTCAATATA TGTGAGTTTG ATTATTATTG TTTGCTTCTT TTATTTTGTT GTCATCCCTA TATTAAATGT GATTGTTTTC TTGGGTATTG TTTCTTGGGA  ATAAGCTGTA TCTAAAATTT ATAAAAGTCT TGAAAGTTCA GAATGTTATT ATTAAGTTAT AACGTTTAGT CATTTTGAAA AGCCAAAAAA AAAAAAAACT GAATCACCAT GGATTTGAAT  ATTGAGACCA TAATTAAGTT AAACAATGTA TTTTTTATTA TTAATTAATA ATAAAAGTTA AGATTTGAAG GAAAATGGTT AAAAACCACC AACTTCAGCA GAACATCTGT TCCAAACTTT  AAGAATCCTG GGACGACCTT TAGAGGCAAA TGGTTTGTAA TAATAAGTCT GAAACAAAAG ATTCCTCAGC ACCATGTGAC ATTCTTGGCC ATATATGATC ATTTTCAGAC AACAATACCT  CGAAGTTGGT ATGTTTTGAA GAATCTCAGA CATGACTTGA TCGCTACATT TTTCTCCCCC CATCAAGCCA GCGCAAGTCC CGGCAAACTG AACAAGTTCT GTTGACTGTT TATTAAGCAT  GTCTATATTG TATTCACTCG TACTCGGAGA TCTTGCAAAC GTGGAATCTA AATCAATATT GGGATCTATC AACGGTTTCT CATCATCTGC CAAACTTGGA TAAGCAAACA GTACCAACGT  GGTGATTAGA ACAAAAGCCA TGTAAACGTG ATTATTTTTC TTCATTTTTT TATTTTATAA CTTAGCCTCC TCTTTCACCT ATTTACTCCT TGTAAATAAA ATTTGTATGT GTATAGAGAT  TATATACCCT AAACACACAG TAGTCAACTG AATGTTATTA ACTTATCCGT TATATTGTAA TTAATAAAAC TACGTTTTGT TTCTTTGTTT GTTTTCTATT AACAAAAAAA ATGATTTACT 
CTATAAAATT TGACGTTTTT TTTTGTAATA AAAAATATGT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCTAAGCGACTAGTTGTCTCTTGCTTGTTCTTAGTTTTGTTGTTTGCTCAAGCCAATTCGCAAGGTTTGAAAGTAGGTTTCTACAGCAAAACATGCCCACAACTCGAGGGT
ATAGTTAAAAAGGTCGTGTTCGATGCGATGAACAAAGCACCAACACTTGGTGCTCCTTTGCTTAGAATGTTCTTCCACGACTGCTTCGTTCGG
GTATGTTTCTGTAATAAGTGAAATGAA
TAATGATTTTAATATATTTCATGATGTCACGTTCTTAATAATGTGAGTGAATCGTGTATGATCAACAGGGATGTGACGGATCAGTTTTGTTAGATAAACCAAACAATCAAGGTGAGAAGA
GTGCAGTTCCTAACCTAAGTCTTCGAGGGTTTGGCATCATAGACGATTCCAAGGCGGCTCTAGAAAAAGTGTGTCCGGGAATTGTTTCTTGCTCTGATATCTTGGCACTTGTCGCTAGAG
ACGCAATGGTTGCA
GTAAGTAATTTTCACATAATACAAAATTTCTACATATATACAAATATAATAGAGCTCTCTTTTAATTTATTATATATCCTGAATATGTTAATTTCTAGCTTGAAGG
ACCATCATGGGAAGTTGAAACGGGAAGAAGAGACGGTAGGGTTTCTAACATCAACGAAGTCAACTTGCCATCACCTTTTGATAACATCACCAAGCTTATCAGCGATTTTCGCTCAAAGGG
CCTCAACGAGAAGGATCTAGTCATTCTCTCGG
GTACGCAAAAGTGAATTAATGATATTTACTATAGTCTGAAAAATGAATAATTAATGATGGAGAATATACATGTTTTTCTAAAGGTGGT
CACACAATTGGAATGGGACATTGTCCTTTATTGACAAACCGGCTTTACAACTTCACCGGAAAAGGAGACAGCGACCCAAGTTTGGACTCGGAGTACGCCGCTAAGCTCAGGAAGAAATGC
AAGCCCACCGATACGACGACGGCTCTAGAGATGGATCCGGGGAGTTTCAAAACATTTGACTTGAGCTACTTCACGCTAGTGGCTAAGAGAAGAGGACTTTTCCAGTCGGATGCTGCTCTA
CTCGACAACTCCAAGACTAGGGCTTATGTCTTGCAACAGATAAGAACTCATGGGTCAATGTTCTTTAACGACTTTGGTGTCTCTATGGTGAAAATGGGTCGGACTGGAGTTCTTACGGGT
AAGGCCGGGGAGATCCGTAAGACGTGTCGGTCTGCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCTAAGCGACTAGTTGTCTCTTGCTTGTTCTTAGTTTTGTTGTTTGCTCAAGCCAATTCGCAAGGTTTGAAAGTAGGTTTCTACAGCAAAACATGCCCACAACTCGAGGGT
ATAGTTAAAAAGGTCGTGTTCGATGCGATGAACAAAGCACCAACACTTGGTGCTCCTTTGCTTAGAATGTTCTTCCACGACTGCTTCGTTCGG
GGATGTGACGGATCAGTTTTGTTAGAT
AAACCAAACAATCAAGGTGAGAAGAGTGCAGTTCCTAACCTAAGTCTTCGAGGGTTTGGCATCATAGACGATTCCAAGGCGGCTCTAGAAAAAGTGTGTCCGGGAATTGTTTCTTGCTCT
GATATCTTGGCACTTGTCGCTAGAGACGCAATGGTTGCA
CTTGAAGGACCATCATGGGAAGTTGAAACGGGAAGAAGAGACGGTAGGGTTTCTAACATCAACGAAGTCAACTTGCCATCA
CCTTTTGATAACATCACCAAGCTTATCAGCGATTTTCGCTCAAAGGGCCTCAACGAGAAGGATCTAGTCATTCTCTCGG
GTGGTCACACAATTGGAATGGGACATTGTCCTTTATTGACA
AACCGGCTTTACAACTTCACCGGAAAAGGAGACAGCGACCCAAGTTTGGACTCGGAGTACGCCGCTAAGCTCAGGAAGAAATGCAAGCCCACCGATACGACGACGGCTCTAGAGATGGAT
CCGGGGAGTTTCAAAACATTTGACTTGAGCTACTTCACGCTAGTGGCTAAGAGAAGAGGACTTTTCCAGTCGGATGCTGCTCTACTCGACAACTCCAAGACTAGGGCTTATGTCTTGCAA
CAGATAAGAACTCATGGGTCAATGTTCTTTAACGACTTTGGTGTCTCTATGGTGAAAATGGGTCGGACTGGAGTTCTTACGGGTAAGGCCGGGGAGATCCGTAAGACGTGTCGGTCTGCT
AATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTATCAATC GAGCAAAAAA CAAAAGCTAA GAGCAACAAA CTAAAGATTT TTTAAGAAAA TGGCAGCTTC TAAGCGACTA GTTGTCTCTT GCTTGTTCTT AGTTTTGTTG TTTGCTCAAG  CCAATTCGCA AGGTTTGAAA GTAGGTTTCT ACAGCAAAAC ATGCCCACAA CTCGAGGGTA TAGTTAAAAA GGTCGTGTTC GATGCGATGA ACAAAGCACC AACACTTGGT GCTCCTTTGC  TTAGAATGTT CTTCCACGAC TGCTTCGTTC GGGGATGTGA CGGATCAGTT TTGTTAGATA AACCAAACAA TCAAGGTGAG AAGAGTGCAG TTCCTAACCT AAGTCTTCGA GGGTTTGGCA  TCATAGACGA TTCCAAGGCG GCTCTAGAAA AAGTGTGTCC GGGAATTGTT TCTTGCTCTG ATATCTTGGC ACTTGTCGCT AGAGACGCAA TGGTTGCACT TGAAGGACCA TCATGGGAAG  TTGAAACGGG AAGAAGAGAC GGTAGGGTTT CTAACATCAA CGAAGTCAAC TTGCCATCAC CTTTTGATAA CATCACCAAG CTTATCAGCG ATTTTCGCTC AAAGGGCCTC AACGAGAAGG  ATCTAGTCAT TCTCTCGGGT GGTCACACAA TTGGAATGGG ACATTGTCCT TTATTGACAA ACCGGCTTTA CAACTTCACC GGAAAAGGAG ACAGCGACCC AAGTTTGGAC TCGGAGTACG  CCGCTAAGCT CAGGAAGAAA TGCAAGCCCA CCGATACGAC GACGGCTCTA GAGATGGATC CGGGGAGTTT CAAAACATTT GACTTGAGCT ACTTCACGCT AGTGGCTAAG AGAAGAGGAC  TTTTCCAGTC GGATGCTGCT CTACTCGACA ACTCCAAGAC TAGGGCTTAT GTCTTGCAAC AGATAAGAAC TCATGGGTCA ATGTTCTTTA ACGACTTTGG TGTCTCTATG GTGAAAATGG  GTCGGACTGG AGTTCTTACG GGTAAGGCCG GGGAGATCCG TAAGACGTGT CGGTCTGCTA ATTAAGAGAT ATAGAAATGA AAATATCTCA ATATATGTGA GTTTGATTAT TATTGTTTGC  TTCTTTTATT TTGTTGTCAT CCCTATATTA AATGTGATTG TTTTCTTGGG TATTGTTTCT TGGGAATAAG CTGTATCTAA AATTTATAAA AGTCTTGAAA GTTCAGAATG TTATTATTAA 
GTT 

Retrieve as FASTA