Entry information : TaurGPx01
Entry ID 12014
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: TaurGPx01
Name TaurGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Thermoascus
Organism Thermoascus aurantiacus    [TaxId: 5087 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TaurGPx01
start..stop
S start..stop
AfumGPx 306 1e-107 1..182 45..235
NfGPx 302 5e-106 1..182 46..240
AteGPx 300 8e-106 1..180 1..180
AnGPx 300 8e-105 1..181 85..261
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 508153..508195 43 N° 2 507533..508035 503  
complement(join(507533..508035,508153..508195))


exon

Literature and cross-references TaurGPx01
DNA ref. JGI genome:   scaffold_1 (508195..507533)
Cluster/Prediction ref. JGI gene:   35250
Protein sequence: TaurGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   183
PWM (Da):   %s   20263.26  
PI (pH):   %s   8.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSARTFFDFEPKDKKGDPFPLSSLRGKVVLAVNTASKCGFTPQFKGLESLYQSIQSKHPDSFTILGFPCNQFGGQDPGTNDEIQTFCQVNYGVTFPVLGKTEVNGDKAEPVWEWMKNEMPGIMGLKRVKWNFEKFLISAEGKVVGRWASTTKPESLEETILKEIEKAKANKAKEGEQAKL

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCCGCAAGGACCTTCTTTGACTTCGAGCCCAAAGACAGTATGTCCCTCCCTCTCACCCCGTCCCATCCCATCCCCGCAGCTCCCCGCACCTCCATCCTGGAGCATCTATATACA
GTCATCAGCACGACCCATTCAAGCTGACTGCCCCTTCCAGAGAAGGGCGACCCCTTCCCCCTCTCCTCCCTCAGAGGCAAAGTCGTCCTCGCCGTCAACACCGCCTCCAAATGCGGCTTC
ACCCCGCAATTCAAGGGCCTCGAATCCCTCTACCAGTCCATTCAATCCAAGCACCCGGACTCCTTCACCATCCTCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCGGGCACCAAC
GACGAGATCCAGACCTTCTGCCAGGTCAACTACGGCGTGACGTTCCCGGTGCTGGGCAAGACCGAGGTCAACGGCGACAAGGCGGAGCCCGTGTGGGAGTGGATGAAGAACGAGATGCCG
GGCATCATGGGCCTGAAGCGGGTCAAGTGGAACTTTGAGAAGTTCTTGATCTCCGCGGAGGGCAAGGTTGTCGGGCGCTGGGCGAGCACGACCAAGCCGGAGAGTCTGGAGGAGACGATT
CTGAAGGAGATTGAGAAGGCCAAGGCGAATAAGGCGAAGGAGGGGGAGCAGGCCAAGTTGTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCCGCAAGGACCTTCTTTGACTTCGAGCCCAAAGACAAGAAGGGCGACCCCTTCCCCCTCTCCTCCCTCAGAGGCAAAGTCGTCCTCGCCGTCAACACCGCCTCCAAATGCGGC
TTCACCCCGCAATTCAAGGGCCTCGAATCCCTCTACCAGTCCATTCAATCCAAGCACCCGGACTCCTTCACCATCCTCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCGGGCACC
AACGACGAGATCCAGACCTTCTGCCAGGTCAACTACGGCGTGACGTTCCCGGTGCTGGGCAAGACCGAGGTCAACGGCGACAAGGCGGAGCCCGTGTGGGAGTGGATGAAGAACGAGATG
CCGGGCATCATGGGCCTGAAGCGGGTCAAGTGGAACTTTGAGAAGTTCTTGATCTCCGCGGAGGGCAAGGTTGTCGGGCGCTGGGCGAGCACGACCAAGCCGGAGAGTCTGGAGGAGACG
ATTCTGAAGGAGATTGAGAAGGCCAAGGCGAATAAGGCGAAGGAGGGGGAGCAGGCCAAGTTGTCT

Retrieve as FASTA