Entry information : MrubCcP01
Entry ID 12015
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: MrubCcP01
Name MrubCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Elaphomycetaceae Monascus
Organism Monascus ruber    [TaxId: 89489 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MrubCcP01
start..stop
S start..stop
NfCcP02 570 0 12..366 12..366
AfumCcP02 569 0 12..366 12..366
AwenCcP02 568 0 1..366 1..365
TstCcP02 565 0 1..366 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41886..42242 357 N° 2 41066..41809 744  
complement(join(41066..41809,41886..42242))


exon

Literature and cross-references MrubCcP01
DNA ref. JGI genome:   scaffold_42 (42242..41066)
Cluster/Prediction ref. JGI gene:   432784
Protein sequence: MrubCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367
PWM (Da):   %s   40743.39 Transmb domain:   %s   i59-76o
PI (pH):   %s   8.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARTASRAFSRSIPATSSLRPAARSSRFALQTQTLRFAPRRGYASEAEPKKSSNTWLWIAGIAVAGGYGAYLYRKGDSPLAAKTFAPTKEDYQKVYDEVARLLVEKDDYDDGSYGPVLVRLAWHSSGTYDKETGTGGSNGATMRFAPEAEHGANAGLKVARDFLEPVKAKFPWISYGDLWTLAGTCAIQEAGGPAIPWRPGRQDQDVSACTPDGRLPDAAKDQRHVRDIFYRMGFNDQEIVALLGAHALGRAHPDRSGFDGPWDFSPTVFTNEFYKLLLSEKWVHRKWSGPDQFTDNSSKSLMMLPTDMSLIKDKEFKKYVELYAKDNDTFFKDFSDAFVKLLELGVPFTNKAEDRFVFKTSE*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCTGCCAGGACTGCCTCCCGGGCCTTCTCCCGATCTATCCCTGCCACCTCCTCTCTCAGACCGGCTGCTCGCAGCTCCCGCTTCGCTCTTCAGACTCAAACACTCCGTTTC
GCTCCTCGTCGCGGATATGCCTCTGAGGCGGAACCGAAGAAGTCGTCCAATACCTGGCTGTGGATAGCTGGTATCGCCGTCGCTGGCGGGTATGGCGCCTACCTCTACCGGAAAGGTGAC
AGCCCCTTGGCAGCCAAGACGTTCGCCCCCACCAAGGAGGACTACCAGAAGGTGTACGATGAGGTCGCAAGATTGCTGGTGGAGAAGGACGACTATGACGATGGTAGCTATGGACCG
GTA
TGTTCCAACTTCTCCGGGAAGGTGGCATATGTTCGGAACCGAGCAGTGGGCTGACGTAGAGTCGATAAAACAGGTTCTTGTTCGTTTGGCATGGCACTCCAGCGGTACCTATGATAAGGA
GACGGGTACCGGTGGTAGCAACGGAGCTACCATGAGGTTCGCGCCCGAAGCGGAACACGGTGCCAACGCCGGGCTCAAGGTCGCAAGAGACTTCCTGGAACCTGTCAAGGCGAAATTCCC
CTGGATCTCTTATGGTGATCTCTGGACCCTTGCTGGTACTTGCGCCATCCAGGAAGCTGGCGGTCCTGCCATCCCTTGGAGGCCTGGTCGTCAGGACCAGGATGTCTCTGCCTGCACTCC
TGACGGACGCCTCCCTGATGCTGCCAAGGACCAGAGGCACGTTCGTGACATCTTCTACCGCATGGGCTTTAACGACCAAGAGATTGTTGCCCTGCTTGGTGCACACGCTCTTGGACGTGC
ACATCCCGACCGCTCTGGTTTCGATGGCCCCTGGGATTTCAGCCCGACTGTCTTCACCAACGAGTTCTACAAGCTCCTGTTGAGTGAGAAGTGGGTTCACAGGAAGTGGAGCGGTCCTGA
CCAATTTACCGACAACTCGAGCAAGTCTCTGATGATGCTTCCGACCGACATGTCCCTGATCAAGGATAAGGAGTTCAAGAAGTACGTCGAGCTCTATGCCAAGGACAACGACACCTTCTT
CAAGGACTTCTCCGACGCCTTCGTCAAGCTCCTCGAGCTCGGTGTCCCCTTTACCAACAAGGCTGAAGACCGATTCGTCTTCAAGACTTCCGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCTGCCAGGACTGCCTCCCGGGCCTTCTCCCGATCTATCCCTGCCACCTCCTCTCTCAGACCGGCTGCTCGCAGCTCCCGCTTCGCTCTTCAGACTCAAACACTCCGTTTC
GCTCCTCGTCGCGGATATGCCTCTGAGGCGGAACCGAAGAAGTCGTCCAATACCTGGCTGTGGATAGCTGGTATCGCCGTCGCTGGCGGGTATGGCGCCTACCTCTACCGGAAAGGTGAC
AGCCCCTTGGCAGCCAAGACGTTCGCCCCCACCAAGGAGGACTACCAGAAGGTGTACGATGAGGTCGCAAGATTGCTGGTGGAGAAGGACGACTATGACGATGGTAGCTATGGACCG
GTT
CTTGTTCGTTTGGCATGGCACTCCAGCGGTACCTATGATAAGGAGACGGGTACCGGTGGTAGCAACGGAGCTACCATGAGGTTCGCGCCCGAAGCGGAACACGGTGCCAACGCCGGGCTC
AAGGTCGCAAGAGACTTCCTGGAACCTGTCAAGGCGAAATTCCCCTGGATCTCTTATGGTGATCTCTGGACCCTTGCTGGTACTTGCGCCATCCAGGAAGCTGGCGGTCCTGCCATCCCT
TGGAGGCCTGGTCGTCAGGACCAGGATGTCTCTGCCTGCACTCCTGACGGACGCCTCCCTGATGCTGCCAAGGACCAGAGGCACGTTCGTGACATCTTCTACCGCATGGGCTTTAACGAC
CAAGAGATTGTTGCCCTGCTTGGTGCACACGCTCTTGGACGTGCACATCCCGACCGCTCTGGTTTCGATGGCCCCTGGGATTTCAGCCCGACTGTCTTCACCAACGAGTTCTACAAGCTC
CTGTTGAGTGAGAAGTGGGTTCACAGGAAGTGGAGCGGTCCTGACCAATTTACCGACAACTCGAGCAAGTCTCTGATGATGCTTCCGACCGACATGTCCCTGATCAAGGATAAGGAGTTC
AAGAAGTACGTCGAGCTCTATGCCAAGGACAACGACACCTTCTTCAAGGACTTCTCCGACGCCTTCGTCAAGCTCCTCGAGCTCGGTGTCCCCTTTACCAACAAGGCTGAAGACCGATTC
GTCTTCAAGACTTCCGAGTAG

Retrieve as FASTA