Entry information : MrubCcP02
Entry ID 12016
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: MrubCcP02
Name MrubCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Elaphomycetaceae Monascus
Organism Monascus ruber    [TaxId: 89489 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MrubCcP02
start..stop
S start..stop
AteCcP01_NIH2624 542 0 3..305 2..305
AniCcP01 533 0 3..300 2..300
AclCcP01 532 0 3..302 2..302
AnCcP01 528 0 3..300 2..300
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21873..21985 113 N° 2 22068..22872 805  
join(21873..21985,22068..22872)


exon

Literature and cross-references MrubCcP02
DNA ref. JGI genome:   scaffold_134 (21873..22872)
Cluster/Prediction ref. JGI gene:   389209
Protein sequence: MrubCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306
PWM (Da):   %s   33634.91  
PI (pH):   %s   6.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKPGDYDAVRKDIAAQLKKPGYDDGSAAPVFVRLAWHSAGTYDKETDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKERHPWITYSDLWTLAGVVAIKEAGGPDVPWQPGRTDLVNDSKVPPRGRLPDGAQGADHVRHVFYRMGFNDQEIVALVGGHNLGRCHADRSGFQGPWVNNPTRFSNQFYKLLLKLEWKPKTLDNGVKQFVFVDPDFPDDEPLMMLPTDVALATDPSFRSWVEKYAEDRDLFYDHFSKAFAKLIELGIRRDETGKIVNTDNVLGGYVSAPKKSNTPTGPVKAKL

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCAAGCCAGGGGATTACGACGCCGTGCGCAAGGATATTGCTGCCCAGTTGAAGAAGCCCGGCTATGACGATGGGAGTGCGGCGCCTGTGTTTGTGAGATTGGCATGGTATGTT
TTCTTGCTGTTGTGTCTGCAGTCTGCAGTCTTCAGTCTTCAGCCAGACAGCTCATTAACCATGTCGTCCGAACAGGCACTCCGCAGGCACATACGACAAGGAAACAGACACGGGCGGTTC
CAACGGCGCTGGCATGCGCTATGAAGCAGAAGGCGGCGACCCCGCCAACGCAGGACTCCAACACGGCCGCGCGTTTCTCGAACCCGTCAAGGAACGACACCCGTGGATCACGTACTCTGA
TCTCTGGACGCTGGCCGGTGTCGTAGCCATCAAGGAAGCCGGCGGCCCCGACGTCCCCTGGCAACCGGGCCGGACGGATCTCGTCAACGACTCCAAGGTGCCTCCGCGCGGTCGTCTGCC
GGACGGAGCTCAGGGCGCCGACCACGTCCGTCACGTCTTCTACCGCATGGGCTTCAACGATCAGGAGATTGTCGCTCTTGTCGGCGGCCACAATCTCGGCCGGTGCCATGCGGACCGCTC
CGGGTTTCAGGGCCCCTGGGTGAACAACCCGACCCGCTTCTCGAATCAGTTCTATAAGCTCCTGCTCAAGCTGGAATGGAAGCCCAAGACGCTTGACAATGGCGTGAAGCAGTTTGTCTT
CGTGGATCCGGATTTCCCCGATGACGAACCTCTCATGATGCTGCCCACGGATGTTGCGTTGGCGACTGATCCGTCCTTCAGGTCGTGGGTGGAGAAATACGCCGAGGATCGCGATCTGTT
CTACGACCACTTCTCCAAGGCTTTCGCCAAGCTGATCGAGTTGGGTATTCGTCGTGATGAGACGGGTAAGATCGTCAACACCGATAATGTCCTGGGTGGGTATGTTTCCGCGCCCAAGAA
GAGTAATACCCCTACTGGACCGGTAAAGGCGAAGCTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCAAGCCAGGGGATTACGACGCCGTGCGCAAGGATATTGCTGCCCAGTTGAAGAAGCCCGGCTATGACGATGGGAGTGCGGCGCCTGTGTTTGTGAGATTGGCATGGCACTCC
GCAGGCACATACGACAAGGAAACAGACACGGGCGGTTCCAACGGCGCTGGCATGCGCTATGAAGCAGAAGGCGGCGACCCCGCCAACGCAGGACTCCAACACGGCCGCGCGTTTCTCGAA
CCCGTCAAGGAACGACACCCGTGGATCACGTACTCTGATCTCTGGACGCTGGCCGGTGTCGTAGCCATCAAGGAAGCCGGCGGCCCCGACGTCCCCTGGCAACCGGGCCGGACGGATCTC
GTCAACGACTCCAAGGTGCCTCCGCGCGGTCGTCTGCCGGACGGAGCTCAGGGCGCCGACCACGTCCGTCACGTCTTCTACCGCATGGGCTTCAACGATCAGGAGATTGTCGCTCTTGTC
GGCGGCCACAATCTCGGCCGGTGCCATGCGGACCGCTCCGGGTTTCAGGGCCCCTGGGTGAACAACCCGACCCGCTTCTCGAATCAGTTCTATAAGCTCCTGCTCAAGCTGGAATGGAAG
CCCAAGACGCTTGACAATGGCGTGAAGCAGTTTGTCTTCGTGGATCCGGATTTCCCCGATGACGAACCTCTCATGATGCTGCCCACGGATGTTGCGTTGGCGACTGATCCGTCCTTCAGG
TCGTGGGTGGAGAAATACGCCGAGGATCGCGATCTGTTCTACGACCACTTCTCCAAGGCTTTCGCCAAGCTGATCGAGTTGGGTATTCGTCGTGATGAGACGGGTAAGATCGTCAACACC
GATAATGTCCTGGGTGGGTATGTTTCCGCGCCCAAGAAGAGTAATACCCCTACTGGACCGGTAAAGGCGAAGCTATAG

Retrieve as FASTA