Entry information : MrubGPx01
Entry ID 12017
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: MrubGPx01
Name MrubGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Elaphomycetaceae Monascus
Organism Monascus ruber    [TaxId: 89489 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MrubGPx01
start..stop
S start..stop
NfGPx 326 2e-115 1..193 46..240
AteGPx 322 2e-114 1..185 1..184
AclGPx 319 3e-113 1..184 1..184
AfumGPx 321 3e-113 1..193 45..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 54353..54395 43 N° 2 53712..54247 536  
complement(join(53712..54247,54353..54395))


exon

Literature and cross-references MrubGPx01
DNA ref. JGI genome:   scaffold_7 (54395..53712)
Cluster/Prediction ref. JGI gene:   428855
Protein sequence: MrubGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   21196.93  
PI (pH):   %s   8.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATTFYSFDPVDKKGEPFPLSSLKGKVVLVVNTASKCGFTPQFKGLETLYQSVKTKHPEDFLILGFPCNQFGSQDPGSNDEIQTFCQVNYGVTFPVLGKLDVNGDHAAPLFTWLKEKQPGLLGLKRVKWNFEKFLVSAEGDVVGRWASTTKPEGLEKTILEEIEKGSKKGVLASQTKAKEQSSETEQAKL

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCGCAACTACGTTCTACAGCTTCGACCCTGTCGACAGTAAGTGTCTCTATTTGCGTTGTTCTTCCCCCAACGAACCCAGCGCAAAATACTTTGATCAACGAACAAATATGAAA
TGAACCCATCTAACCAACGGTCAAACAGAAAAGGGAGAGCCCTTCCCCCTTTCCTCTCTGAAGGGCAAAGTCGTCCTTGTCGTCAACACTGCCTCTAAATGCGGCTTCACCCCGCAATTC
AAGGGCCTTGAAACCCTCTACCAGTCCGTCAAAACCAAGCATCCCGAGGACTTCCTCATCCTCGGCTTCCCTTGCAACCAGTTCGGCAGTCAGGATCCCGGTTCCAACGATGAGATCCAG
ACTTTCTGCCAGGTCAACTACGGCGTGACTTTCCCCGTTCTGGGCAAGCTGGACGTGAACGGTGACCATGCCGCGCCGCTTTTCACCTGGTTGAAGGAGAAGCAGCCCGGGTTACTGGGT
CTGAAGAGAGTTAAGTGGAATTTCGAGAAGTTCCTGGTCTCCGCGGAGGGGGACGTCGTCGGCAGATGGGCTAGTACTACCAAGCCGGAAGGTTTGGAGAAGACGATTCTTGAAGAGATT
GAGAAGGGTTCCAAGAAGGGGGTTTTGGCGTCTCAGACTAAGGCCAAGGAACAGTCTTCTGAGACGGAGCAGGCTAAGCTCTCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCGCAACTACGTTCTACAGCTTCGACCCTGTCGACAAAAAGGGAGAGCCCTTCCCCCTTTCCTCTCTGAAGGGCAAAGTCGTCCTTGTCGTCAACACTGCCTCTAAATGCGGC
TTCACCCCGCAATTCAAGGGCCTTGAAACCCTCTACCAGTCCGTCAAAACCAAGCATCCCGAGGACTTCCTCATCCTCGGCTTCCCTTGCAACCAGTTCGGCAGTCAGGATCCCGGTTCC
AACGATGAGATCCAGACTTTCTGCCAGGTCAACTACGGCGTGACTTTCCCCGTTCTGGGCAAGCTGGACGTGAACGGTGACCATGCCGCGCCGCTTTTCACCTGGTTGAAGGAGAAGCAG
CCCGGGTTACTGGGTCTGAAGAGAGTTAAGTGGAATTTCGAGAAGTTCCTGGTCTCCGCGGAGGGGGACGTCGTCGGCAGATGGGCTAGTACTACCAAGCCGGAAGGTTTGGAGAAGACG
ATTCTTGAAGAGATTGAGAAGGGTTCCAAGAAGGGGGTTTTGGCGTCTCAGACTAAGGCCAAGGAACAGTCTTCTGAGACGGAGCAGGCTAAGCTCTCG

Retrieve as FASTA