Entry information : ClunCP01
Entry ID 12018
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ClunCP01
Name ClunCP01
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus lunatus (Curvularia lunata)    [TaxId: 5503 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ClunCP01
start..stop
S start..stop
SturCP 1453 0 1..760 1..759
COsaCP 1452 0 1..760 1..761
CheCP_C5 1447 0 1..760 1..761
CheCP_C4 1447 0 1..760 1..761
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1158234..1158493 260 N° 2 1157702..1158177 476 N° 3 1156104..1157650 1547  
complement(join(1156104..1157650,1157702..1158177,1158234..1158493))


exon

Literature and cross-references ClunCP01
DNA ref. JGI genome:   scaffold_15 (1158493..1156104)
Cluster/Prediction ref. JGI gene:   45464
Protein sequence: ClunCP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   761
PWM (Da):   %s   84278.23  
PI (pH):   %s   6.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKGECPVKVANVAGAGTRNSDWWPNELRTNILRQHDPRQNPLGPDFNYAEEFKKLDYDGLKKDLTALMTDSQDWWPADFGHYGGLFIRLSWHSAGTYRVTDGRGGGGDGQQRFAPLNAWPDNVSLDKARRLLWPIKQKYGNKISWADLMLLAGNVALESMGCPTFGFAGGRTDTFQSDESVYWGGETEWLGSDVRYADGAKGVKGSGIIDGEQHKTESTQPHTSRNLEQPLAASHMGLIYVNPEGPEGVPDPVAAAHDIRTTFGRMAMNDEETAALIIGGHSFGKTHGAAPASNTGPDPNSEDLATQGLGWMNKHGRGNGPDTITSGLEVTWTGTPTKWSNKYLEYLYKFEWELEKSPAGAHQWVAKTDEKIIPDAYDPNVKHKPRMLTTDLSMRMDPAYEKITRRWLEHPEELHDAFTRAWFKLLHRDMGPRSRWLGPEVPKEVLLWEDPVPQPEGEIIGDAEIQTLKKQVLEAGIEPAKLIRTAWASAASFRGSDKRGGANGARIRLAPQKDWEVNNPKELAEVLKALEGIQSKFNSGSSKKVSLADLIVLAGTAAVEKAAGVPVPFTPGRTDATQEQTDVQSFEHLEPVTDGFRNYGKGTQRVRTEQLDVDKAHLLRLTAPEMVVLTGGLRALNANWDGSSHGIFTNRPGQLTNDFFVNLLDNNLEWKATDASKELYEGYDRKSGQKKWTGTRHDLIFGHHPELRAIAETYSLPDNTNKFVKDFVAGWEKIMNNDRFDIKNKSVSTPSSGASRPRL*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAAAGGCGAGTGTCCCGTCAAGGTCGCAAACGTCGCCGGCGCCGGTACAAGAAACTCGGACTGGTGGCCAAATGAGCTCAGGACAAACATTCTGCGCCAGCATGACCCCAGACAG
AACCCTCTCGGCCCTGACTTCAACTACGCTGAGGAGTTCAAGAAACTCGACTACGATGGACTCAAGAAGGATCTCACGGCCTTGATGACCGACTCCCAGGACTGGTGGCCTGCCGACTTT
GGTCACTATGGTGGTCTTTT
GTACGTTGGTCCCTCGTCTTCTTAGTCCCTGCCTTTGTCTCTAACAAGTTTAATAGCATCCGTCTGTCTTGGCACTCCGCTGGTACATACCGTGTGACCG
ACGGCCGTGGTGGCGGTGGTGACGGCCAGCAGCGCTTTGCCCCTCTCAATGCCTGGCCCGACAATGTCTCTCTCGACAAGGCCCGCCGCCTCCTCTGGCCCATCAAGCAAAAGTATGGCA
ACAAGATCTCCTGGGCCGATCTCATGCTCCTCGCCGGAAACGTCGCCCTTGAATCCATGGGTTGCCCAACCTTTGGTTTCGCTGGTGGACGCACCGACACCTTCCAGTCGGACGAGTCCG
TCTACTGGGGTGGTGAGACTGAGTGGCTCGGCAGCGATGTCCGTTACGCAGATGGCGCAAAGGGCGTCAAGGGCTCGGGCATCATCGACGGCGAACAGCACAAGACCGAGTCAACCCAGC
CTCACACATCGAGGAACCTTGAGCAGCCATTGGCTGCTTCGCACATGGGTCTCATCTACGTGAACCCAGAGG
GTGAGTTACTTCCTTGGGTTTGTAAAATCTGACCTTGGCTTACTCTTT
CAGGTCCCGAGGGTGTACCGGATCCCGTTGCCGCCGCCCACGACATCCGCACAACCTTTGGCCGTATGGCTATGAACGACGAGGAGACTGCTGCCCTCATCATTGGTGGCCACTCGTTCG
GAAAGACACACGGTGCTGCTCCCGCCTCCAACACCGGCCCAGACCCCAACTCAGAGGACCTTGCCACACAGGGACTGGGTTGGATGAACAAGCACGGCCGTGGCAATGGCCCAGACACCA
TCACCAGTGGTCTCGAAGTCACCTGGACTGGCACACCCACCAAGTGGAGCAACAAGTACCTCGAGTACCTCTACAAGTTTGAGTGGGAGCTGGAGAAGAGCCCCGCTGGTGCCCACCAGT
GGGTTGCTAAGACCGACGAGAAGATTATTCCCGACGCCTACGACCCCAACGTTAAGCACAAGCCCAGGATGCTTACCACCGACTTGTCGATGCGCATGGACCCTGCCTACGAGAAGATTA
CTCGTCGCTGGCTAGAGCACCCCGAGGAGCTTCACGACGCTTTCACCCGTGCCTGGTTCAAGCTTCTCCACCGTGACATGGGTCCTCGCTCCAGGTGGCTCGGCCCAGAGGTCCCCAAGG
AGGTCCTTCTCTGGGAGGACCCTGTTCCCCAGCCAGAGGGCGAGATCATTGGCGACGCCGAGATCCAGACTCTTAAGAAGCAAGTTCTCGAGGCTGGTATCGAGCCCGCCAAGCTCATCC
GCACTGCCTGGGCTTCAGCAGCTTCTTTCCGAGGTAGCGACAAGCGTGGTGGTGCCAACGGCGCTCGTATCCGCCTTGCTCCCCAGAAGGACTGGGAGGTCAACAACCCCAAGGAGTTGG
CCGAGGTCCTCAAGGCTCTTGAGGGCATTCAGTCCAAGTTCAATAGCGGCAGCAGCAAGAAGGTTTCTCTGGCTGACTTGATTGTCCTCGCTGGTACCGCTGCCGTTGAGAAGGCTGCTG
GTGTACCCGTTCCATTTACTCCAGGCCGCACCGACGCCACCCAGGAGCAGACTGACGTTCAGTCTTTCGAGCACCTTGAGCCCGTCACCGACGGTTTCCGCAACTACGGAAAGGGCACTC
AGCGTGTCCGAACCGAGCAGCTCGATGTTGACAAGGCACACCTTCTCCGCCTCACTGCCCCCGAGATGGTTGTCCTCACTGGTGGTCTGCGCGCCCTGAACGCCAACTGGGACGGTTCTT
CTCACGGTATCTTCACCAACCGCCCTGGTCAGCTTACCAACGACTTCTTTGTCAACCTCCTTGACAACAACCTCGAGTGGAAGGCAACCGATGCCAGCAAGGAGCTGTACGAGGGCTATG
ACCGCAAGTCTGGCCAGAAGAAGTGGACTGGTACCCGCCACGACCTCATCTTTGGTCACCACCCTGAGCTCCGTGCCATTGCCGAGACGTACTCGCTTCCCGACAACACGAACAAGTTTG
TGAAGGACTTTGTGGCTGGATGGGAGAAGATTATGAACAATGACCGCTTTGATATCAAGAACAAGTCGGTGAGTACACCATCAAGCGGGGCAAGCAGGCCTCGACTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAAAGGCGAGTGTCCCGTCAAGGTCGCAAACGTCGCCGGCGCCGGTACAAGAAACTCGGACTGGTGGCCAAATGAGCTCAGGACAAACATTCTGCGCCAGCATGACCCCAGACAG
AACCCTCTCGGCCCTGACTTCAACTACGCTGAGGAGTTCAAGAAACTCGACTACGATGGACTCAAGAAGGATCTCACGGCCTTGATGACCGACTCCCAGGACTGGTGGCCTGCCGACTTT
GGTCACTATGGTGGTCTTTT
CATCCGTCTGTCTTGGCACTCCGCTGGTACATACCGTGTGACCGACGGCCGTGGTGGCGGTGGTGACGGCCAGCAGCGCTTTGCCCCTCTCAATGCCTGG
CCCGACAATGTCTCTCTCGACAAGGCCCGCCGCCTCCTCTGGCCCATCAAGCAAAAGTATGGCAACAAGATCTCCTGGGCCGATCTCATGCTCCTCGCCGGAAACGTCGCCCTTGAATCC
ATGGGTTGCCCAACCTTTGGTTTCGCTGGTGGACGCACCGACACCTTCCAGTCGGACGAGTCCGTCTACTGGGGTGGTGAGACTGAGTGGCTCGGCAGCGATGTCCGTTACGCAGATGGC
GCAAAGGGCGTCAAGGGCTCGGGCATCATCGACGGCGAACAGCACAAGACCGAGTCAACCCAGCCTCACACATCGAGGAACCTTGAGCAGCCATTGGCTGCTTCGCACATGGGTCTCATC
TACGTGAACCCAGAGG
GTCCCGAGGGTGTACCGGATCCCGTTGCCGCCGCCCACGACATCCGCACAACCTTTGGCCGTATGGCTATGAACGACGAGGAGACTGCTGCCCTCATCATTGGT
GGCCACTCGTTCGGAAAGACACACGGTGCTGCTCCCGCCTCCAACACCGGCCCAGACCCCAACTCAGAGGACCTTGCCACACAGGGACTGGGTTGGATGAACAAGCACGGCCGTGGCAAT
GGCCCAGACACCATCACCAGTGGTCTCGAAGTCACCTGGACTGGCACACCCACCAAGTGGAGCAACAAGTACCTCGAGTACCTCTACAAGTTTGAGTGGGAGCTGGAGAAGAGCCCCGCT
GGTGCCCACCAGTGGGTTGCTAAGACCGACGAGAAGATTATTCCCGACGCCTACGACCCCAACGTTAAGCACAAGCCCAGGATGCTTACCACCGACTTGTCGATGCGCATGGACCCTGCC
TACGAGAAGATTACTCGTCGCTGGCTAGAGCACCCCGAGGAGCTTCACGACGCTTTCACCCGTGCCTGGTTCAAGCTTCTCCACCGTGACATGGGTCCTCGCTCCAGGTGGCTCGGCCCA
GAGGTCCCCAAGGAGGTCCTTCTCTGGGAGGACCCTGTTCCCCAGCCAGAGGGCGAGATCATTGGCGACGCCGAGATCCAGACTCTTAAGAAGCAAGTTCTCGAGGCTGGTATCGAGCCC
GCCAAGCTCATCCGCACTGCCTGGGCTTCAGCAGCTTCTTTCCGAGGTAGCGACAAGCGTGGTGGTGCCAACGGCGCTCGTATCCGCCTTGCTCCCCAGAAGGACTGGGAGGTCAACAAC
CCCAAGGAGTTGGCCGAGGTCCTCAAGGCTCTTGAGGGCATTCAGTCCAAGTTCAATAGCGGCAGCAGCAAGAAGGTTTCTCTGGCTGACTTGATTGTCCTCGCTGGTACCGCTGCCGTT
GAGAAGGCTGCTGGTGTACCCGTTCCATTTACTCCAGGCCGCACCGACGCCACCCAGGAGCAGACTGACGTTCAGTCTTTCGAGCACCTTGAGCCCGTCACCGACGGTTTCCGCAACTAC
GGAAAGGGCACTCAGCGTGTCCGAACCGAGCAGCTCGATGTTGACAAGGCACACCTTCTCCGCCTCACTGCCCCCGAGATGGTTGTCCTCACTGGTGGTCTGCGCGCCCTGAACGCCAAC
TGGGACGGTTCTTCTCACGGTATCTTCACCAACCGCCCTGGTCAGCTTACCAACGACTTCTTTGTCAACCTCCTTGACAACAACCTCGAGTGGAAGGCAACCGATGCCAGCAAGGAGCTG
TACGAGGGCTATGACCGCAAGTCTGGCCAGAAGAAGTGGACTGGTACCCGCCACGACCTCATCTTTGGTCACCACCCTGAGCTCCGTGCCATTGCCGAGACGTACTCGCTTCCCGACAAC
ACGAACAAGTTTGTGAAGGACTTTGTGGCTGGATGGGAGAAGATTATGAACAATGACCGCTTTGATATCAAGAACAAGTCGGTGAGTACACCATCAAGCGGGGCAAGCAGGCCTCGACTA
TGA

Retrieve as FASTA