Entry information : ClunCcP01
Entry ID 12021
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ClunCcP01
Name ClunCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus lunatus (Curvularia lunata)    [TaxId: 5503 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ClunCcP01
start..stop
S start..stop
CheCcP_C4 727 0 1..372 1..373
COsaCcP 724 0 1..372 1..373
AalteCcP01 723 0 1..372 1..374
AbraCcP 717 0 1..372 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1047894..1048300 407 N° 2 1047123..1047834 712  
complement(join(1047123..1047834,1047894..1048300))


exon

Literature and cross-references ClunCcP01
DNA ref. JGI genome:   scaffold_5 (1048300..1047123)
Cluster/Prediction ref. JGI gene:   144218
Protein sequence: ClunCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   41684.49  
PI (pH):   %s   7.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASRTFSRALRTAAPSFRTTATRTSARFVAPTQNAFRNQRRGYASEDGPDKHEGNPTGLAWGAGALLLGAGGYALYTYKPELFGQTSTKIFTPRFEDYQKVYDEIAKRLEEHDDYDDGSYGPVLLRLAWHASGTFDKLTGTGGSNGATMRFAPEGDHGANAGLKAARDFLEPVKEAFPWISYSDLWILAGVCAIQEMQGPKIPYRAGRTDRDVAFCTPDGRLPDASKDSSHIRAIFGRMGFDDRAMVALSGAHALGRCHTDRSGYDGPWTFSPTTLTNDYYKLLLEEKWAYKKWNGPKQFEDVKTKSLMMLPTDMELVKDKSFRQYTQLYAKDNDAFFKDFSEAVMTLFELGVPFQHPEDQRWVFKSSFD

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGGCCTCACGAACCTTTTCCCGCGCTCTGCGCACCGCTGCACCTTCTTTCCGCACCACCGCCACCCGCACCTCTGCCCGCTTCGTTGCTCCCACACAAAACGCCTTCCGCAAC
CAACGACGCGGATATGCTTCTGAGGATGGTCCTGATAAGCACGAGGGCAACCCAACCGGTCTAGCCTGGGGTGCGGGCGCTCTGCTTCTCGGTGCTGGTGGTTATGCTCTCTACACATAC
AAGCCAGAGCTTTTTGGCCAGACCAGCACCAAGATCTTCACTCCCCGCTTCGAGGACTACCAGAAGGTCTACGACGAAATTGCAAAGAGGCTGGAGGAGCACGATGACTACGATGACGGC
AGCTATGGCCCTGTGCTCCTGCGTCTTGCATGGCACGCTTCCGGAAC
GTGAGTGCATTCAATTGTCCTTTTTCACTACTCCAAAATTCAATACTAACATGATGCAGTTTCGACAAGCTGA
CCGGAACTGGTGGCTCCAACGGTGCTACCATGCGCTTTGCCCCCGAGGGTGACCACGGTGCCAACGCCGGTCTCAAGGCTGCCCGTGACTTCCTCGAGCCTGTCAAGGAGGCCTTCCCAT
GGATCAGCTACTCTGATCTCTGGATTCTTGCTGGTGTTTGCGCCATCCAAGAGATGCAGGGCCCTAAGATCCCCTACCGTGCTGGCCGTACCGATCGTGACGTCGCGTTCTGCACTCCCG
ATGGTCGTCTGCCCGATGCCAGCAAGGACAGCAGCCACATTCGTGCCATCTTTGGCCGTATGGGCTTCGACGACCGTGCCATGGTTGCCCTGTCTGGTGCCCACGCCCTCGGCCGCTGCC
ACACCGACCGTTCTGGCTACGACGGCCCCTGGACCTTCTCGCCTACCACTCTGACCAACGACTACTACAAGCTTCTTCTCGAGGAGAAGTGGGCCTACAAGAAGTGGAACGGCCCCAAGC
AGTTTGAGGATGTCAAGACCAAGAGCCTCATGATGCTGCCAACTGACATGGAGCTCGTCAAGGACAAGAGTTTCAGGCAGTACACTCAGCTGTACGCAAAGGACAATGACGCCTTCTTCA
AGGACTTCTCCGAGGCTGTCATGACCCTGTTTGAGCTCGGTGTGCCATTCCAGCACCCTGAGGACCAGCGATGGGTCTTCAAGAGCTCTTTTGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGGCCTCACGAACCTTTTCCCGCGCTCTGCGCACCGCTGCACCTTCTTTCCGCACCACCGCCACCCGCACCTCTGCCCGCTTCGTTGCTCCCACACAAAACGCCTTCCGCAAC
CAACGACGCGGATATGCTTCTGAGGATGGTCCTGATAAGCACGAGGGCAACCCAACCGGTCTAGCCTGGGGTGCGGGCGCTCTGCTTCTCGGTGCTGGTGGTTATGCTCTCTACACATAC
AAGCCAGAGCTTTTTGGCCAGACCAGCACCAAGATCTTCACTCCCCGCTTCGAGGACTACCAGAAGGTCTACGACGAAATTGCAAAGAGGCTGGAGGAGCACGATGACTACGATGACGGC
AGCTATGGCCCTGTGCTCCTGCGTCTTGCATGGCACGCTTCCGGAAC
TTTCGACAAGCTGACCGGAACTGGTGGCTCCAACGGTGCTACCATGCGCTTTGCCCCCGAGGGTGACCACGGT
GCCAACGCCGGTCTCAAGGCTGCCCGTGACTTCCTCGAGCCTGTCAAGGAGGCCTTCCCATGGATCAGCTACTCTGATCTCTGGATTCTTGCTGGTGTTTGCGCCATCCAAGAGATGCAG
GGCCCTAAGATCCCCTACCGTGCTGGCCGTACCGATCGTGACGTCGCGTTCTGCACTCCCGATGGTCGTCTGCCCGATGCCAGCAAGGACAGCAGCCACATTCGTGCCATCTTTGGCCGT
ATGGGCTTCGACGACCGTGCCATGGTTGCCCTGTCTGGTGCCCACGCCCTCGGCCGCTGCCACACCGACCGTTCTGGCTACGACGGCCCCTGGACCTTCTCGCCTACCACTCTGACCAAC
GACTACTACAAGCTTCTTCTCGAGGAGAAGTGGGCCTACAAGAAGTGGAACGGCCCCAAGCAGTTTGAGGATGTCAAGACCAAGAGCCTCATGATGCTGCCAACTGACATGGAGCTCGTC
AAGGACAAGAGTTTCAGGCAGTACACTCAGCTGTACGCAAAGGACAATGACGCCTTCTTCAAGGACTTCTCCGAGGCTGTCATGACCCTGTTTGAGCTCGGTGTGCCATTCCAGCACCCT
GAGGACCAGCGATGGGTCTTCAAGAGCTCTTTTGACTAG

Retrieve as FASTA