Entry information : ClunCIIAB03
Entry ID 12025
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ClunCIIAB03
Name ClunCIIAB03
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus lunatus (Curvularia lunata)    [TaxId: 5503 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ClunCIIAB03
start..stop
S start..stop
COsaCIIAB01 487 3e-175 1..331 1..327
CheCIIAB01_C5 476 8e-171 1..331 1..327
CheCIIAB01_C4 476 8e-171 1..331 1..327
AbraCIIAB01 442 3e-157 1..332 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 617021..617612 592 N° 2 616547..616956 410  
complement(join(616547..616956,617021..617612))


exon

Literature and cross-references ClunCIIAB03
DNA ref. JGI genome:   scaffold_3 (617612..616547)
Cluster/Prediction ref. JGI gene:   17005
Protein sequence: ClunCIIAB03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (314)
PWM (Da):   %s   35099.43 (33054.3)  
PI (pH):   %s   8.2 (7.68) Peptide Signal:   %s   cut: 20 range:20-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYIRSVLLSGLVAASTAQAYTNDTLSKEETPWIVADVSPTVQKRQFFNVFSLLNNVFGANTQDPAECPPIWTQISETLTQQFSADGECTDAARAAIRAAFHDCFPGACDGSLILANECAQSESNGLQRFCSNLASVASQTSVGVGDLIQFAAAHAVKTCPGGPTIPVSVGRQDSSQPNDFKILPRGSARGNDLVRLFASKGFTPTDLAALIGAHSTAKQRFVSPANAGAGMDSTPGVWDVKYYTETRQGSAPFTLQSDRNIARNPATSLQFAAFGVNKGAWDAAFVSAMVKMSMMGVSGRKMVDCTSALPGGSAADAKKRGVESRGVFGRIKL*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAGCGTTCTTCTCTCAGGCCTAGTGGCTGCCAGCACAGCCCAAGCCTACACCAACGACACCCTCTCTAAAGAAGAAACACCCTGGATCGTCGCCGATGTATCCCCCACT
GTCCAAAAAAGGCAATTCTTCAACGTCTTCAGCCTGCTGAACAACGTCTTCGGCGCCAACACCCAAGACCCAGCCGAATGCCCACCCATCTGGACCCAAATCTCTGAAACCCTGACGCAG
CAATTCTCCGCAGACGGCGAATGCACAGATGCCGCTCGAGCGGCCATCCGCGCCGCTTTCCATGACTGCTTCCCCGGCGCATGTGACGGGTCACTCATTCTCGCCAACGAATGCGCCCAG
TCCGAAAGCAACGGCTTACAACGCTTCTGCAGCAACCTCGCGAGCGTCGCCTCTCAAACCAGCGTCGGCGTAGGTGACCTCATCCAATTCGCCGCAGCCCATGCCGTCAAGACCTGCCCA
GGCGGTCCCACAATACCTGTCAGCGTCGGCCGACAAGACTCCTCTCAACCCAACGACTTCAAGATCCTACCAAGAGGTAGCGCAAGAGGAAACGATCTCGTAAGACTCTTTG
GTAAGTTT
CCCCTTTCTCACTCTTTTCCTAAGGTTTCTTCATAAACTAACATCAACCGCCCCAGCATCAAAAGGCTTTACACCCACCGACCTCGCCGCCCTAATCGGTGCCCACTCGACCGCAAAACA
ACGCTTCGTGTCCCCCGCCAACGCAGGCGCCGGTATGGACTCGACCCCAGGTGTTTGGGACGTAAAATACTACACCGAGACGCGCCAAGGTAGCGCCCCTTTTACACTCCAGTCCGACAG
GAACATAGCTCGTAATCCGGCTACGTCGCTGCAGTTTGCGGCGTTTGGGGTGAACAAGGGGGCATGGGATGCGGCGTTTGTGAGTGCCATGGTTAAGATGAGTATGATGGGCGTGAGTGG
GAGGAAGATGGTGGATTGTACGTCGGCATTGCCCGGGGGTAGTGCGGCGGATGCGAAGAAGAGGGGGGTTGAGAGTAGGGGCGTGTTTGGCAGGATAAAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATTCGCAGCGTTCTTCTCTCAGGCCTAGTGGCTGCCAGCACAGCCCAAGCCTACACCAACGACACCCTCTCTAAAGAAGAAACACCCTGGATCGTCGCCGATGTATCCCCCACT
GTCCAAAAAAGGCAATTCTTCAACGTCTTCAGCCTGCTGAACAACGTCTTCGGCGCCAACACCCAAGACCCAGCCGAATGCCCACCCATCTGGACCCAAATCTCTGAAACCCTGACGCAG
CAATTCTCCGCAGACGGCGAATGCACAGATGCCGCTCGAGCGGCCATCCGCGCCGCTTTCCATGACTGCTTCCCCGGCGCATGTGACGGGTCACTCATTCTCGCCAACGAATGCGCCCAG
TCCGAAAGCAACGGCTTACAACGCTTCTGCAGCAACCTCGCGAGCGTCGCCTCTCAAACCAGCGTCGGCGTAGGTGACCTCATCCAATTCGCCGCAGCCCATGCCGTCAAGACCTGCCCA
GGCGGTCCCACAATACCTGTCAGCGTCGGCCGACAAGACTCCTCTCAACCCAACGACTTCAAGATCCTACCAAGAGGTAGCGCAAGAGGAAACGATCTCGTAAGACTCTTTG
CATCAAAA
GGCTTTACACCCACCGACCTCGCCGCCCTAATCGGTGCCCACTCGACCGCAAAACAACGCTTCGTGTCCCCCGCCAACGCAGGCGCCGGTATGGACTCGACCCCAGGTGTTTGGGACGTA
AAATACTACACCGAGACGCGCCAAGGTAGCGCCCCTTTTACACTCCAGTCCGACAGGAACATAGCTCGTAATCCGGCTACGTCGCTGCAGTTTGCGGCGTTTGGGGTGAACAAGGGGGCA
TGGGATGCGGCGTTTGTGAGTGCCATGGTTAAGATGAGTATGATGGGCGTGAGTGGGAGGAAGATGGTGGATTGTACGTCGGCATTGCCCGGGGGTAGTGCGGCGGATGCGAAGAAGAGG
GGGGTTGAGAGTAGGGGCGTGTTTGGCAGGATAAAGCTGTAG

Retrieve as FASTA