Entry information : MdurCcP02
Entry ID 12029
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: MdurCcP02
Name MdurCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Myriangiaceae Myriangium
Organism Myriangium duriaei    [TaxId: 147570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MdurCcP02
start..stop
S start..stop
ApruCcP02 526 0 1..319 1..318
BcomCcP 524 0 1..319 1..320
AresCcP01 520 0 1..319 1..324
MvarCcP02 513 0 1..319 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 689389..689498 110 N° 2 688490..689339 850  
complement(join(688490..689339,689389..689498))


exon

Literature and cross-references MdurCcP02
DNA ref. JGI genome:   scaffold_11 (689498..688490)
Cluster/Prediction ref. JGI gene:   323925
Protein sequence: MdurCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320
PWM (Da):   %s   34947.53  
PI (pH):   %s   6.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTKGDYAAVRKDIAALLHQPEYDDGSAGPVLVRLAWHSAGTYDATTDTGGSNGAGMRYESEGGDPANAGLQHARVFLEPVKEKHSWITYSDLWILAGIVAVREMGGPDVPFSPGRTDYVDDSKLPPRGRLPDGAQGAAHIRHVFGRMGFSDQEIVALSGAHNLGRCHADRSGFDGAWVQNPTRFSNSYFRLMLSLTWKEKTLPNGVKQFVHVDEDLGQELMMLPTDLALVNDPQFRPWVELYAKDKDRFFEDFSAVFHKLTELGIRRDAKGKVLNSDNVKGGYVSAPKKSDSPGLPSKSGDGEAEPLKKENSALRARL

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCAAAGGCGACTACGCCGCCGTCCGCAAGGACATCGCGGCCCTCCTCCACCAGCCCGAATACGATGACGGTAGCGCTGGCCCCGTCCTCGTCCGTCTAGCATGGTACATCACC
TCCCCATGCCCTCTATCTACCTCCCACTAACCCCTCTAGGCACTCAGCAGGCACCTACGACGCCACGACCGACACAGGCGGCTCCAACGGCGCGGGCATGCGCTACGAATCCGAAGGCGG
CGACCCCGCCAACGCCGGCCTGCAACACGCACGTGTCTTCCTCGAGCCCGTCAAAGAAAAGCACTCGTGGATAACCTACTCGGATCTCTGGATCCTCGCCGGCATCGTCGCCGTCCGCGA
GATGGGCGGTCCCGACGTCCCCTTCTCCCCGGGCCGGACAGACTACGTCGACGACTCCAAGCTCCCCCCGCGCGGTCGTCTCCCCGACGGCGCCCAGGGCGCAGCGCACATCCGCCACGT
CTTCGGGCGCATGGGCTTCAGCGACCAGGAGATTGTCGCCTTGTCCGGCGCACATAACCTCGGCCGGTGCCACGCCGACCGGTCCGGGTTTGACGGCGCGTGGGTGCAGAACCCGACGCG
GTTCAGCAACAGCTACTTCCGGCTGATGCTGAGTCTCACATGGAAGGAGAAGACGCTGCCGAACGGCGTGAAGCAGTTCGTGCACGTCGACGAGGACCTGGGCCAGGAGCTGATGATGTT
GCCCACGGATCTGGCGCTGGTCAATGATCCGCAGTTCCGGCCGTGGGTGGAGCTGTACGCCAAGGACAAGGACCGATTCTTTGAGGACTTTTCGGCTGTGTTCCACAAGTTGACGGAGTT
GGGCATCAGGAGGGATGCGAAGGGCAAAGTGTTGAATTCGGACAATGTCAAGGGCGGGTATGTCAGCGCGCCGAAGAAGAGCGATAGCCCTGGGTTGCCGAGCAAGAGTGGTGATGGCGA
GGCGGAGCCGTTGAAGAAGGAGAACTCGGCTCTCAGGGCGAGATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCAAAGGCGACTACGCCGCCGTCCGCAAGGACATCGCGGCCCTCCTCCACCAGCCCGAATACGATGACGGTAGCGCTGGCCCCGTCCTCGTCCGTCTAGCATGGCACTCAGCA
GGCACCTACGACGCCACGACCGACACAGGCGGCTCCAACGGCGCGGGCATGCGCTACGAATCCGAAGGCGGCGACCCCGCCAACGCCGGCCTGCAACACGCACGTGTCTTCCTCGAGCCC
GTCAAAGAAAAGCACTCGTGGATAACCTACTCGGATCTCTGGATCCTCGCCGGCATCGTCGCCGTCCGCGAGATGGGCGGTCCCGACGTCCCCTTCTCCCCGGGCCGGACAGACTACGTC
GACGACTCCAAGCTCCCCCCGCGCGGTCGTCTCCCCGACGGCGCCCAGGGCGCAGCGCACATCCGCCACGTCTTCGGGCGCATGGGCTTCAGCGACCAGGAGATTGTCGCCTTGTCCGGC
GCACATAACCTCGGCCGGTGCCACGCCGACCGGTCCGGGTTTGACGGCGCGTGGGTGCAGAACCCGACGCGGTTCAGCAACAGCTACTTCCGGCTGATGCTGAGTCTCACATGGAAGGAG
AAGACGCTGCCGAACGGCGTGAAGCAGTTCGTGCACGTCGACGAGGACCTGGGCCAGGAGCTGATGATGTTGCCCACGGATCTGGCGCTGGTCAATGATCCGCAGTTCCGGCCGTGGGTG
GAGCTGTACGCCAAGGACAAGGACCGATTCTTTGAGGACTTTTCGGCTGTGTTCCACAAGTTGACGGAGTTGGGCATCAGGAGGGATGCGAAGGGCAAAGTGTTGAATTCGGACAATGTC
AAGGGCGGGTATGTCAGCGCGCCGAAGAAGAGCGATAGCCCTGGGTTGCCGAGCAAGAGTGGTGATGGCGAGGCGGAGCCGTTGAAGAAGGAGAACTCGGCTCTCAGGGCGAGATTGTAG

Retrieve as FASTA