Entry information : MdurGPx01
Entry ID 12032
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: MdurGPx01
Name MdurGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Myriangiaceae Myriangium
Organism Myriangium duriaei    [TaxId: 147570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MdurGPx01
start..stop
S start..stop
MfiGPx01 292 2e-102 1..164 54..217
ZcelGPx01 290 2e-101 1..164 50..213
CzmGPx 285 5e-100 1..166 38..203
LpaluGPx01 281 5e-98 1..165 67..231
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 618158..618200 43 N° 2 617640..618103 464  
complement(join(617640..618103,618158..618200))


exon

Literature and cross-references MdurGPx01
DNA ref. JGI genome:   scaffold_4 (618200..617640)
Cluster/Prediction ref. JGI gene:   327146
Protein sequence: MdurGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18638.51  
PI (pH):   %s   9.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYDFSPKDKKGSPYPLSATKGKVVLVVNTASKCGFTPQFGGLETLYKQLKSKHPDFEIIGFPCNQFGGQDPGSDGEIQTFCQVNYGVTFPILGKTDVNGDKAEPVYEWMKAQKSGILGLKRIKWNFEKFLIGRDGQVKQRWASTTNPETLKDAIEAELAQGK

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCAACAAGCTTCTACGACTTCTCGCCCAAGGACAGTACGTGCCTCTCGGTCTCCTTCCCCAATGCGCCTGACTAACCTGTTCTTGCAGAAAAGGGCTCCCCCTACCCTCTC
TCCGCGACCAAGGGCAAAGTCGTCCTCGTTGTCAACACAGCCAGCAAATGCGGCTTCACCCCTCAGTTCGGCGGCCTTGAAACCCTATACAAGCAGCTGAAGTCCAAGCACCCCGACTTC
GAGATCATCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCCGGCTCCGACGGCGAGATCCAGACCTTCTGCCAGGTCAACTACGGCGTCACCTTCCCCATCCTCGGCAAGACCGAC
GTCAACGGCGACAAGGCCGAGCCCGTCTACGAGTGGATGAAGGCCCAGAAGTCCGGCATCCTCGGCCTGAAGCGCATCAAGTGGAACTTTGAGAAGTTCCTCATCGGCCGCGACGGCCAG
GTCAAGCAGCGCTGGGCCAGCACGACGAACCCGGAGACCTTGAAGGATGCGATCGAGGCGGAGCTCGCGCAGGGGAAGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCAACAAGCTTCTACGACTTCTCGCCCAAGGACAAAAAGGGCTCCCCCTACCCTCTCTCCGCGACCAAGGGCAAAGTCGTCCTCGTTGTCAACACAGCCAGCAAATGCGGC
TTCACCCCTCAGTTCGGCGGCCTTGAAACCCTATACAAGCAGCTGAAGTCCAAGCACCCCGACTTCGAGATCATCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCCGGCTCCGAC
GGCGAGATCCAGACCTTCTGCCAGGTCAACTACGGCGTCACCTTCCCCATCCTCGGCAAGACCGACGTCAACGGCGACAAGGCCGAGCCCGTCTACGAGTGGATGAAGGCCCAGAAGTCC
GGCATCCTCGGCCTGAAGCGCATCAAGTGGAACTTTGAGAAGTTCCTCATCGGCCGCGACGGCCAGGTCAAGCAGCGCTGGGCCAGCACGACGAACCCGGAGACCTTGAAGGATGCGATC
GAGGCGGAGCTCGCGCAGGGGAAGAAA

Retrieve as FASTA