Entry information : Lu1CysPrx51(Lus10008810|PACid:23151894)
Entry ID 12033
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: Lu1CysPrx51(Lus10008810|PACid:23151894)
Name Lu1CysPrx51(Lus10008810|PACid:23151894)
Class 1-Cysteine peroxiredoxin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Lu1CysPrx51
start..stop
S start..stop
Lu1CysPrx93 135 6e-42 1..82 133..214
Lu1CysPrx219 132 2e-40 1..82 133..214
Egl1CysPrx03-1 125 6e-38 1..82 115..196
Ecam1CysPrx03-1 125 8e-38 1..82 133..214
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 104133..104150 18 N° 2 104232..104531 300  
join(104133..104150,104232..104531)


exon

Literature and cross-references Lu1CysPrx51(Lus10008810|PACid:23151894)
DNA ref. Phytozome 11:   scaffold300 (104133..104531)
Protein sequence: Lu1CysPrx51(Lus10008810|PACid:23151894)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   105
PWM (Da):   %s   11998.29  
PI (pH):   %s   10.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRDKKIKLSFLYPAITGRNMEEVMRVMESLKRASKHKIATPAEWKLGDAVVISPSVSNEEAAKIFPQGYKTTGLLSIKGWIWDEYFSLSINQNWNLVEKLGFRD*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTGATAAGAAGGTTAATTTCTAGCTTAATTGCTTGGTTGATAATGGATTTCAGTTTGGTTGGATTATTAATTGGGGGAAATGATGATTGCAGATAAAGCTGAGCTTTCTGTAC
CCAGCGATCACGGGGAGGAACATGGAGGAAGTTATGAGGGTGATGGAGTCACTGAAGAGGGCATCGAAGCACAAGATAGCAACTCCGGCAGAGTGGAAGCTAGGGGATGCTGTGGTGATA
TCGCCTAGCGTGTCAAATGAGGAGGCTGCTAAGATTTTCCCACAGGGATACAAGACTACCGGCCTGCTTTCCATAAAAGGCTGGATATGGGATGAATACTTCAGTCTCTCCATTAACCAA
AATTGGAATTTAGTGGAGAAATTGGGGTTTAGGGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTGATAAGAAGATAAAGCTGAGCTTTCTGTACCCAGCGATCACGGGGAGGAACATGGAGGAAGTTATGAGGGTGATGGAGTCACTGAAGAGGGCATCGAAGCACAAGATAGCA
ACTCCGGCAGAGTGGAAGCTAGGGGATGCTGTGGTGATATCGCCTAGCGTGTCAAATGAGGAGGCTGCTAAGATTTTCCCACAGGGATACAAGACTACCGGCCTGCTTTCCATAAAAGGC
TGGATATGGGATGAATACTTCAGTCTCTCCATTAACCAAAATTGGAATTTAGTGGAGAAATTGGGGTTTAGGGATTGA

Retrieve as FASTA