Entry information : Lu1CysPrx93(Lus10017112|PACid:23167432)
Entry ID 12034
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: Lu1CysPrx93(Lus10017112|PACid:23167432)
Name Lu1CysPrx93(Lus10017112|PACid:23167432)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Lu1CysPrx93
start..stop
S start..stop
Lu1CysPrx219 444 7e-162 1..220 1..220
Egu1CysPrx03 389 6e-140 1..220 1..220
Egr1CysPrx03 389 6e-140 1..220 1..220
Ecam1CysPrx03-2 385 2e-138 1..220 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 320498..320764 267 N° 2 320867..321013 147 N° 3 321110..321358 249  
join(320498..320764,320867..321013,321110..321358)


exon

Literature and cross-references Lu1CysPrx93(Lus10017112|PACid:23167432)
DNA ref. Phytozome 11:   scaffold216 (320498..321358)
Protein sequence: Lu1CysPrx93(Lus10017112|PACid:23167432)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24319.34  
PI (pH):   %s   6.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTVPNLEVESTHGVINLHDFFTNSWTILFSHPGDFTPVCTTELGKMAAYAPEFEKRGVKLLGLSCDDVLSHVEWIKDVEAFTPGSKVTYPIISDPNRDVIKQLNMVDPDEKDPSGNNVPSRALHIVGPDKKIKLSFLYPASTGRNMEEVMRVVESLQRASKHKIATPADWKPGDAVVISPSVSNEEADKMFPQGYKIADLPSKKGYLRFTHVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGACTCACCATTGGGGACACCGTCCCAAATCTTGAAGTGGAGAGCACTCATGGAGTCATCAATCTCCACGACTTCTTCACCAATTCCTGGACCATCCTCTTTTCTCACCCCGGT
GATTTCACGCCGGTGTGCACCACGGAACTAGGGAAGATGGCAGCTTATGCGCCGGAGTTTGAGAAGAGAGGGGTCAAACTCCTGGGCTTGTCATGCGACGACGTTTTGTCTCATGTCGAG
TGGATCAAGGACGTAGAAGCCTTCACC
GTGAGCTAAAACTAACCTCGATCCTTTCCGATTAATTTCGTCGTCACCGTTATCTAACAGAAACAGAGTAATTAATTTTTTAAAATTTCCCGT
AATTTGTAGCCGGGGAGCAAGGTGACGTACCCAATCATCTCCGATCCGAATCGGGATGTAATAAAGCAGCTGAACATGGTGGATCCCGACGAGAAAGATCCATCGGGGAACAACGTCCCT
TCCCGTGCTCTGCATATTGTGGGCCCTGATAAGAAG
GTTAAAAAGTTTGTATACGCTGTGGTCACTTGATTTCTAGAGTTGGGTTTGGCTGATCTGATTATTAATTGAGGAAAATGATGG
ATGGATGCGCAGATAAAGCTGAGCTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGAGGAAGTGATGAGGGTGGTGGAGTCGCTGCAGAGGGCGTCGAAGCACAAGATAGCAACTCCG
GCGGACTGGAAGCCAGGGGATGCGGTGGTGATATCTCCCAGCGTGTCCAATGAGGAGGCTGATAAGATGTTCCCCCAGGGGTACAAGATTGCCGACCTCCCTTCCAAGAAAGGCTATCTC
CGCTTTACTCATGTTGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGACTCACCATTGGGGACACCGTCCCAAATCTTGAAGTGGAGAGCACTCATGGAGTCATCAATCTCCACGACTTCTTCACCAATTCCTGGACCATCCTCTTTTCTCACCCCGGT
GATTTCACGCCGGTGTGCACCACGGAACTAGGGAAGATGGCAGCTTATGCGCCGGAGTTTGAGAAGAGAGGGGTCAAACTCCTGGGCTTGTCATGCGACGACGTTTTGTCTCATGTCGAG
TGGATCAAGGACGTAGAAGCCTTCACC
CCGGGGAGCAAGGTGACGTACCCAATCATCTCCGATCCGAATCGGGATGTAATAAAGCAGCTGAACATGGTGGATCCCGACGAGAAAGATCCA
TCGGGGAACAACGTCCCTTCCCGTGCTCTGCATATTGTGGGCCCTGATAAGAAG
ATAAAGCTGAGCTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGAGGAAGTGATGAGGGTGGTG
GAGTCGCTGCAGAGGGCGTCGAAGCACAAGATAGCAACTCCGGCGGACTGGAAGCCAGGGGATGCGGTGGTGATATCTCCCAGCGTGTCCAATGAGGAGGCTGATAAGATGTTCCCCCAG
GGGTACAAGATTGCCGACCTCCCTTCCAAGAAAGGCTATCTCCGCTTTACTCATGTTGACTAG

Retrieve as FASTA