Entry information : LuAPx105(Lus10019906|PACid:23164019)
Entry ID 12038
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-11 (Qiang Li)
Peroxidase information: LuAPx105(Lus10019906|PACid:23164019)
Name LuAPx105(Lus10019906|PACid:23164019)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuAPx105
start..stop
S start..stop
PtriAPx02 439 8e-159 4..246 3..245
CclAPx05 436 1e-157 4..246 3..245
CroAPx02 436 2e-157 4..246 3..245
EglAPx01 435 2e-157 4..246 3..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 611040..611161 122 N° 2 610763..610937 175 N° 3 610605..610670 66 N° 4 610478..610526 49
N° 5 610305..610387 83 N° 6 610143..610222 80 N° 7 609958..610060 103 N° 8 609818..609880 63
complement(join(609818..609880,609958..610060,610143..610222,610305..610387,6104 78..610526,610605..610670,610763..610937,611040..611161))


exon

Literature and cross-references LuAPx105(Lus10019906|PACid:23164019)
DNA ref. Phytozome 12:   scaffold1491 (611161..609818)
Protein sequence: LuAPx105(Lus10019906|PACid:23164019)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247
PWM (Da):   %s   27376.87  
PI (pH):   %s   6.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGEKCYPKVSAEYEKSVMKCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVETKSGGPFGTIRHQEELAHQANNGLDIAVRLLEAIKEQFPILTYADFYQLAGVVAVEITGGPEIPFHPGRPDKPEPPPEGRLPQADGGSAHLRQVFYRMGMNDKDIVALSGGHTLGRCHKERSGFEGPWTANPLIFDNSYFRELLNGEKEGLIQLPSDKALLEDPAFRPLVQKYAHDEDAFFEDYAEAHLKLSELG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGAGAAGTGTTACCCGAAAGTGAGCGCGGAGTACGAGAAATCAGTGATGAAATGCAAGCGGAAGCTGAGAGGCCTCATCGCTGAGAAGCACTGTGCTCCAATCGTCCTCCGACTA
GC
GTAATCACTGATCTTTTTACGTACCCGCTCTATAATTCAAACGACATACGCAATGTAATTCATTACTAATTGAGTAGTACTCCCTGTGTATAATGTGTTAAGATGGCACTCTGCTGGA
ACGTTCGATGTTGAAACCAAGAGCGGAGGTCCGTTTGGGACGATCCGGCATCAGGAAGAGCTTGCCCACCAAGCCAACAACGGGCTTGACATTGCGGTCAGGCTCTTGGAGGCCATCAAG
GAGCAGTTCCCCATCTTAACCTACGCCGATTTCTACCAG
GTTTGCTGCTTTCATCAAATTATCAAGTAGAGATTTCGCACTTTAATGTGTTAATGATATGGATCCATCTCACTTTGTTTA
ATTAATTTCAGCTGGCTGGAGTTGTGGCAGTGGAGATTACCGGAGGCCCGGAGATCCCTTTCCATCCCGGACGGCCGGTTAGTTCCCATAGTACTTGTCTCTTTTTCTCTGATCAGTTAT
CAGGGTCAGTTATTTCATATTCCATACGTCAACAGGACAAACCTGAGCCGCCCCCAGAAGGACGCTTGCCTCAGGCCGATGGAGGTAACTTCGAAACATAGTCAGTTGAGTGAAGTTTGG
TAAGCTTACAGCAACATTTTGGACTTGAGCTTGACTGTCAGCTGTGCATTACAGGGTCAGCCCATTTGAGACAAGTGTTCTACAGAATGGGTATGAATGACAAAGACATAGTTGCTCTAT
CCGGCGGCCACACCTTG
GTAACATACATAGCTTAGCCGGGGATTATATCTGGTTGTTACCCTATGCAATTTAGTGTTGATTTGTTAACTGTTAGTGCAGGGTAGGTGCCATAAGGAACGT
TCGGGTTTCGAAGGACCCTGGACTGCCAACCCTTTAATCTTTGATAACTCCTACTTCAG
GTATCAACTTGATGATTACTGCAAAATTGTGAACTAAAGATCTGTAAGCTGATTAGATACA
ACACAATTTGATCAAGTGTAGGGAATTATTGAATGGGGAGAAAGAGGGTTTGATTCAGCTGCCATCTGACAAGGCTCTTCTGGAGGATCCTGCATTTCGTCCCCTTGTCCAGAAATATGC
TCAT
GTAAGTTCGTAGACTAAAGTACAACCTACCAACGATCCGCAGAAAAACCTGCTGACTTGTGAAGTTTTGATCGCCAGGATGAGGATGCTTTCTTTGAAGACTATGCTGAAGCTCAT
TTGAAACTCTCGGAGCTCGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGAGAAGTGTTACCCGAAAGTGAGCGCGGAGTACGAGAAATCAGTGATGAAATGCAAGCGGAAGCTGAGAGGCCTCATCGCTGAGAAGCACTGTGCTCCAATCGTCCTCCGACTA
GC
ATGGCACTCTGCTGGAACGTTCGATGTTGAAACCAAGAGCGGAGGTCCGTTTGGGACGATCCGGCATCAGGAAGAGCTTGCCCACCAAGCCAACAACGGGCTTGACATTGCGGTCAGG
CTCTTGGAGGCCATCAAGGAGCAGTTCCCCATCTTAACCTACGCCGATTTCTACCAG
CTGGCTGGAGTTGTGGCAGTGGAGATTACCGGAGGCCCGGAGATCCCTTTCCATCCCGGACGG
CCG
GACAAACCTGAGCCGCCCCCAGAAGGACGCTTGCCTCAGGCCGATGGAGGGTCAGCCCATTTGAGACAAGTGTTCTACAGAATGGGTATGAATGACAAAGACATAGTTGCTCTATCC
GGCGGCCACACCTTG
GGTAGGTGCCATAAGGAACGTTCGGGTTTCGAAGGACCCTGGACTGCCAACCCTTTAATCTTTGATAACTCCTACTTCAGGGAATTATTGAATGGGGAGAAAGAG
GGTTTGATTCAGCTGCCATCTGACAAGGCTCTTCTGGAGGATCCTGCATTTCGTCCCCTTGTCCAGAAATATGCTCAT
GATGAGGATGCTTTCTTTGAAGACTATGCTGAAGCTCATTTG
AAACTCTCGGAGCTCGGGTGA

Retrieve as FASTA