Entry information : LuAPx116(Lus10020942|PACid:23177975)
Entry ID 12039
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-11 (Qiang Li)
Peroxidase information: LuAPx116(Lus10020942|PACid:23177975)
Name LuAPx116(Lus10020942|PACid:23177975)
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuAPx116
start..stop
S start..stop
LuAPx50 635 0 22..374 1..356
MeAPx02 536 0 22..374 1..349
PtAPx10 529 0 22..374 1..347
VvAPx07 521 0 22..374 1..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 766406..766582 177 N° 2 766237..766335 99 N° 3 766073..766157 85 N° 4 765948..765982 35
N° 5 765806..765871 66 N° 6 765660..765700 41 N° 7 765450..765580 131 N° 8 765260..765366 107
N° 9 765013..765150 138 N° 10 764196..764330 135 N° 11 763980..764090 111  
complement(join(763980..764090,764196..764330,765013..765150,765260..765366,7654 50..765580,765660..765700,765806..765871,765948..765982,766073..766157,766237..7 66335,766406..766582))


exon

Literature and cross-references LuAPx116(Lus10020942|PACid:23177975)
DNA ref. Phytozome 12:   scaffold711 (766582..763980)
Protein sequence: LuAPx116(Lus10020942|PACid:23177975)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   375
PWM (Da):   %s   39997.44  
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVTTQKSYPPLAVKARKQAAMGVSFLSTTVVPSLHHIPFLSSSSSNAAASSVSSSRHVASATPTIRCAMDGGGGGIRRRDVLTCFGATVGLEVVGSSGSFLETASAADLIQRRQRSDFQTIIKDTLFTAIKGNPEVIPSLLTLALNDIMTYDKATKSGGPNGSVRFSSEMSRPENKGLSVALDLLGEAKKEIDSNSKGGPISFADLIQFGAQSALKATFLASAIRKCGGNEEKGSLLYRAYGSTGQWGLFDRQFGRTDAEEADPEGRVPQWDKASVQEMKDKFVAVGLGPRQLAVMSAFLGPDQAATEAMLATDPDVLPWVQKYQRSRETVSETDYEVDLITALTKLSSLGQNINYEAYTYAVPRIDVSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Extra 5' end.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGTTACAACTCAGAAGTCATATCCTCCTTTGGCTGTAAAAGCAAGGAAGCAGGCAGCTATGGGAGTTTCATTCTTGTCAACGACTGTTGTCCCTTCTCTGCATCATATCCCATTC
CTAAGCTCCTCCTCCTCCAATGCTGCTGCTTCTTCTGTTTCCTCCTCTAGACATGTT
GTGAATTTCTTTCTCTTCCTCATTGGGATATTGTTTTCATTGAGAATGCTGATGTTGAAATTT
GATGCAGGCTTCTGCTACTCCTACAATTCGGTGTGCTATGGATGGAGGTGGTGGTGGCATCCGGAGAAGAGATGTTTTGACATGCTTTGGTGCTACAGTTGGCCTGGTAATCTTTCTGAT
TTCATTTTGGAATGTAGTTTCTTTTCCATCAGTGATATGATCTCTCACAGTTGTCGAATGCTTAGGAAGTTGTGGGAAGCTCAGGATCGTTCCTGGAAACTGCTAGCGCTGCTGACCTCA
TCCAACGCAGACAAAGATCAGATTTCCAGA
GTAAGCAACAGTATAATGGCAACTTTTTCAACTCTCAAGTTTATACTGATTACTGAAAGTTCACGTCTTTTTTTTTGTTTGATCTCACAG

CAATCATTAAGGATACTCTTTTCACAGCAATTAAG
GTACAATAACACTGTTTCCGCAAACAGTATCATAATGAGCATTAATAACATAAATACTACAAACATGACATTGCAGGGAAATCCT
GAAGTCATCCCATCTTTATTGACTTTGGCTCTCAACGACATTATGACTTATGACAAG
GTCAGGCATCTTCTTTATAGTGCCTTCCTGGGTAAAGCATTCTGATTTGGATTCAAGTAAAAA
CAGCTATTAATCATCTTGCGAAGATGTGGTTTAAGTTTGCAGGCTACCAAATCTGGAGGACCAAACGGATCAGTACGATTCAGGTATAATATGCTGTATATTGGCAACGTCAAAGATATC
GTACTCTGTTTTCTCAAAATGTTGTGGTTGCTGTCAATGAAGCTCAGAGATGAGCAGACCTGAAAACAAGGGACTTTCTGTGGCTTTGGATTTACTAGGAGAAGCAAAGAAGGAGATTGA
TTCCAATTCCAAGGGTGGTCCTATCTCCTTTGCTGATCTTATCCAATTTGGAG
GTTTGTTTGTATTTTGTTTGATACTCCAGTCATTCCCATTTTCACTCGGTTCTAAACCTGATTATAT
GTATGTTTCGATAAAGCACAAAGTGCTCTCAAGGCTACATTCCTGGCATCAGCAATTCGAAAGTGTGGCGGAAACGAGGAGAAAGGTTCATTGCTCTACAGAGCTTACGGCTCCACTGGC
CAG
GTAACTGCTTCTCAGTTCCTCATATCGATCGCAACATGTCACAGTCTACGAAGTTTAATTACGTACGTGACAAGTCGGTTCTGTTGAAATTGACTTTGCTCAAGGACAGTGGGGGCT
ATTCGATAGGCAGTTTGGAAGGACAGATGCAGAAGAGGCGGATCCAGAAGGAAGAGTTCCTCAATGGGATAAAGCTAGTGTGCAGGAAATGAAAGACAAGTTTGTAGCGGTTGGCCTTGG
TCCTCGCCAG
GTACTTATAACTGCTGCTCTCACGTATGCTTTGGCATCTAGAATCATGTTTCTTAAGAAAGTTGAATTGAAGTTGGTTGAGGTTGGAAGAGGTTGTGGAAGGAAAGTTGA
ATAGAGTGATAGAAGAGATCCCAAGTGGAATTGTGTTTCACGATCTACTAAACTGGAAATGAAGTTTCATCGGAATCATTTTTTATATCCTTTGGACTCGATTCGGCAATAAAAATCATG
ATTCATAGAAAAGTTGAGTTAAACTAGTTGAAAAAAAGTTGAGTCGAGGATAAAAAGGGTTGTGGAAAGAATGATAAATTAAAGGATACAAATGATTCATTGGAAAGTTTAATTTCCCTT
TGAGTAGATTGAGAAATACATTTCCACTTGGAGTCCGTCCTCTTTTTCCAAGTATGATTTTCAATTCTAACTCAACTTTCTTATACTAATCTTAACTTAATTTCTTTACGAATTGTAATT
TTTGCTGCCAAACCAAGTCTTAATTCAATTTTCCTTCTACGGACCCTCTCAACCTCAACTCAACTTCCTTCCACTTATCTGAATTCAACTTTCGTAGGGATCATGATTTTGGATGCCAAA
CCTTAGCTCAATCATCTCCCAAGAAGATAGTATAGGCCGTAAATGTGATTGTGTTTGTTCGCTTTGGTTTTGCTGGTATGGTATTTTTGCAGCTGGCTGTTATGTCCGCATTCCTGGGGC
CTGATCAAGCTGCCACAGAGGCGATGCTGGCCACAGACCCTGACGTCCTGCCGTGGGTTCAGAAGTACCAGCGCAGTCGAGAGACCGTGTCCGAGACAGATTACGAG
GTTATATCTTCCC
TATAAAATCCCAACTCTTCATCTAGCTACTTCAATATATTGACTCTGCATTTCTGACTCAGTATGGATTGACTTGACGACATGCTATTACAGGTTGATCTCATTACCGCTCTAACGAAAT
TAAGCAGCCTGGGCCAAAACATCAATTATGAGGCCTACACCTATGCTGTCCCAAGGATCGATGTGTCCAAACTCAAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGTTACAACTCAGAAGTCATATCCTCCTTTGGCTGTAAAAGCAAGGAAGCAGGCAGCTATGGGAGTTTCATTCTTGTCAACGACTGTTGTCCCTTCTCTGCATCATATCCCATTC
CTAAGCTCCTCCTCCTCCAATGCTGCTGCTTCTTCTGTTTCCTCCTCTAGACATGTT
GCTTCTGCTACTCCTACAATTCGGTGTGCTATGGATGGAGGTGGTGGTGGCATCCGGAGAAGA
GATGTTTTGACATGCTTTGGTGCTACAGTTGGCCTG
GAAGTTGTGGGAAGCTCAGGATCGTTCCTGGAAACTGCTAGCGCTGCTGACCTCATCCAACGCAGACAAAGATCAGATTTCCAG
A
CAATCATTAAGGATACTCTTTTCACAGCAATTAAGGGAAATCCTGAAGTCATCCCATCTTTATTGACTTTGGCTCTCAACGACATTATGACTTATGACAAGGCTACCAAATCTGGAGGA
CCAAACGGATCAGTACGATTCAG
CTCAGAGATGAGCAGACCTGAAAACAAGGGACTTTCTGTGGCTTTGGATTTACTAGGAGAAGCAAAGAAGGAGATTGATTCCAATTCCAAGGGTGGT
CCTATCTCCTTTGCTGATCTTATCCAATTTGGAG
CACAAAGTGCTCTCAAGGCTACATTCCTGGCATCAGCAATTCGAAAGTGTGGCGGAAACGAGGAGAAAGGTTCATTGCTCTACAGA
GCTTACGGCTCCACTGGCCAG
TGGGGGCTATTCGATAGGCAGTTTGGAAGGACAGATGCAGAAGAGGCGGATCCAGAAGGAAGAGTTCCTCAATGGGATAAAGCTAGTGTGCAGGAAATG
AAAGACAAGTTTGTAGCGGTTGGCCTTGGTCCTCGCCAG
CTGGCTGTTATGTCCGCATTCCTGGGGCCTGATCAAGCTGCCACAGAGGCGATGCTGGCCACAGACCCTGACGTCCTGCCG
TGGGTTCAGAAGTACCAGCGCAGTCGAGAGACCGTGTCCGAGACAGATTACGAG
GTTGATCTCATTACCGCTCTAACGAAATTAAGCAGCCTGGGCCAAAACATCAATTATGAGGCCTAC
ACCTATGCTGTCCCAAGGATCGATGTGTCCAAACTCAAGCTGTAG

Retrieve as FASTA