Entry information : LuAPx50(Lus10008718|PACid:23161986)
Entry ID 12041
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-11 (Qiang Li)
Peroxidase information: LuAPx50(Lus10008718|PACid:23161986)
Name LuAPx50(Lus10008718|PACid:23161986)
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuAPx50
start..stop
S start..stop
LuAPx116 644 0 1..356 22..374
MeAPx02 531 0 1..356 1..349
PtAPx10 525 0 1..356 1..347
VvAPx07 515 0 1..356 1..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 308438..308560 123 N° 2 308269..308367 99 N° 3 308105..308189 85 N° 4 307996..308030 35
N° 5 307856..307921 66 N° 6 307727..307767 41 N° 7 307516..307646 131 N° 8 307322..307428 107
N° 9 307090..307227 138 N° 10 306839..306973 135 N° 11 306628..306738 111  
complement(join(306628..306738,306839..306973,307090..307227,307322..307428,3075 16..307646,307727..307767,307856..307921,307996..308030,308105..308189,308269..3 08367,308438..308560))


exon

Literature and cross-references LuAPx50(Lus10008718|PACid:23161986)
DNA ref. Phytozome 12:   scaffold1635 (308560..306628)
Protein sequence: LuAPx50(Lus10008718|PACid:23161986)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357
PWM (Da):   %s   38043.48  
PI (pH):   %s   6.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVSFLSTTVVPSLHHIPFLRSSSSSNAAAASVSPSSRHVTASATPTIRCAIDGGGGGIRRRDVLTCFGATVGLEVVGSLGSFLETASAADLIQRRQRSDFQSTIKDTLFTAIKGNPEVIPSLLTLALNDVMTYDKATKSGGPNGSVRFSSEMSRLENKGLSVALDLLGEAKKEIDSNSKGGPISFADLIQFGAQSALKATFLAAAIRKCGGNEEKGSLLYRAYGSAGQWGLFDRQFGRTDAEEPDPDGRVPQWEKASVQEMKDKFVAVGLGPRQLAVMSAFLGPDQAATEAMLATDPDVLPWVQKYQRSRETVSETDYEVDLITALTKLSSLGQNINYEAYTYAVPRIDVSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Extra 5'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTTTCATTCTTGTCGACGACTGTTGTCCCTTCTCTGCATCATATCCCATTCCTGAGATCCTCTTCCTCCTCCAATGCTGCTGCTGCTTCTGTTTCCCCCTCCTCTAGACATGTT
ACC
GTGAGTTTCTTTCTCTTCCTCATTGGGATATTGTTTTCATTGGGAATGCTGATGTTGAAATTTGATGCAGGCTTCTGCTACTCCTACAATTCGGTGTGCTATTGATGGAGGTGGTGG
TGGCATCCGGAGAAGAGATGTTTTGACATGTTTTGGTGCCACCGTTGGGCTG
GTATTCTTTCTAAGTTCATTTTGGAATGTAGTTTCTTTCCCATCAGTGATATGATCTCTCACAGTTGT
TGAATGCTTAGGAAGTTGTGGGAAGCTTAGGATCGTTCCTGGAAACGGCTAGCGCTGCTGACCTTATCCAACGCAGACAACGATCAGATTTCCAGTGTAAGCTACAATGGCAAACTTTCA
ACGATCAGATTCAGAGAAAGTTAACGTCTTTTTTTTGTTTGATCTCACAGCAACCATTAAGGATACTCTTTTCACAGCAATTAAGGTACAACAACATTGTTTCTGCAAACAGGATCATAA
TGAACATTAATAATGAGAACTACAAACATGATATTCCAGGGAAATCCTGAAGTCATCCCATCCTTGTTGACTTTGGCCCTCAACGACGTTATGACTTATGACAAGGTCAGGCATCTTCTT
TACAGTGTAAGCTTTCGGATTCCGATTCAAGTAAAAGCAGCTAAACTTAGGAAGGTGTGGTTTAAGTTTGCAGGCTACCAAATCTGGAGGACCAAACGGATCAGTACGATTCAGGTAATA
AATCATGGCTTTGGAAGAATGACAGATCTGAGTTTTTGCTTTTTCTGAAAATGTTGTGGTTGCTGTGAATGAAGCTCAGAGATGAGCAGACTTGAAAACAAGGGACTGTCTGTGGCTTTG
GATTTACTAGGAGAAGCAAAGAAGGAGATTGATTCCAACTCCAAGGGTGGTCCTATCTCCTTTGCTGATCTTATCCAGTTTGGAG
GTTTGTATTGAAATTGATATAAAAAAACTGACCAC
ATTTGTTCGATAATCCGGTTCTAAACCGGACTATATGTATGTTTCTGTAAAGCACAAAGTGCTCTCAAGGCTACATTCCTAGCAGCAGCAATTCGCAAGTGTGGCGGAAACGAAGAGAAA
GGTTCATTGCTGTACAGAGCTTACGGCTCCGCTGGCCAG
GTAACTGCTTCCCAGTTCCTGAATATCGATCGCCACATGATACAGTCTACGGAGTTTGGTTGAGTGACAAGTCGGTTCTGT
TGAATAAGGACAGTGGGGCTTATTCGATAGGCAGTTTGGAAGGACAGATGCAGAGGAGCCGGATCCAGATGGAAGAGTTCCTCAATGGGAGAAAGCTAGTGTGCAGGAAATGAAAGACAA
GTTCGTAGCAGTTGGGCTTGGTCCTCGCCAG
GTACTTACTGCTTCTCCCAATCCTGTAGAATCATGTTTCATAGGAAAGTTGAATTGAAGGTAGTTTAAGAACGTTAGTGGTTGAGTTGG
CAACAATCTTTTATCTCTCTTATGCAGCTGGCTGTTATGTCCGCATTCCTGGGGCCGGATCAAGCTGCTACCGAGGCGATGCTGGCCACAGACCCTGATGTTCTGCCGTGGGTTCAGAAG
TACCAACGCAGTCGAGAGACTGTGTCCGAGACAGATTACGAG
GTTTATATCTTCCCTATAAATCCCAACTCCTCATGTACTTCAATATATTGACTCTGCATTTTTTACTCAGTATGGGTG
ACTTGACGACATGCTATTCCAGGTTGATCTTATTACGGCTCTAACGAAATTAAGCAGCCTAGGCCAGAACATCAATTATGAGGCCTACACCTATGCTGTCCCTAGAATTGATGTGTCCAA
ACTCAAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTTTCATTCTTGTCGACGACTGTTGTCCCTTCTCTGCATCATATCCCATTCCTGAGATCCTCTTCCTCCTCCAATGCTGCTGCTGCTTCTGTTTCCCCCTCCTCTAGACATGTT
ACC
GCTTCTGCTACTCCTACAATTCGGTGTGCTATTGATGGAGGTGGTGGTGGCATCCGGAGAAGAGATGTTTTGACATGTTTTGGTGCCACCGTTGGGCTGGAAGTTGTGGGAAGCTTA
GGATCGTTCCTGGAAACGGCTAGCGCTGCTGACCTTATCCAACGCAGACAACGATCAGATTTCCAGT
CAACCATTAAGGATACTCTTTTCACAGCAATTAAGGGAAATCCTGAAGTCATC
CCATCCTTGTTGACTTTGGCCCTCAACGACGTTATGACTTATGACAAG
GCTACCAAATCTGGAGGACCAAACGGATCAGTACGATTCAGCTCAGAGATGAGCAGACTTGAAAACAAGGGA
CTGTCTGTGGCTTTGGATTTACTAGGAGAAGCAAAGAAGGAGATTGATTCCAACTCCAAGGGTGGTCCTATCTCCTTTGCTGATCTTATCCAGTTTGGAG
CACAAAGTGCTCTCAAGGCT
ACATTCCTAGCAGCAGCAATTCGCAAGTGTGGCGGAAACGAAGAGAAAGGTTCATTGCTGTACAGAGCTTACGGCTCCGCTGGCCAG
TGGGGCTTATTCGATAGGCAGTTTGGAAGGACA
GATGCAGAGGAGCCGGATCCAGATGGAAGAGTTCCTCAATGGGAGAAAGCTAGTGTGCAGGAAATGAAAGACAAGTTCGTAGCAGTTGGGCTTGGTCCTCGCCAG
CTGGCTGTTATGTCC
GCATTCCTGGGGCCGGATCAAGCTGCTACCGAGGCGATGCTGGCCACAGACCCTGATGTTCTGCCGTGGGTTCAGAAGTACCAACGCAGTCGAGAGACTGTGTCCGAGACAGATTACGAG
GTTGATCTTATTACGGCTCTAACGAAATTAAGCAGCCTAGGCCAGAACATCAATTATGAGGCCTACACCTATGCTGTCCCTAGAATTGATGTGTCCAAACTCAAGCTGTAG

Retrieve as FASTA