Entry information : LuAPx79(Lus10014128|PACid:23156862)
Entry ID 12042
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-11 (Qiang Li)
Peroxidase information: LuAPx79(Lus10014128|PACid:23156862)
Name LuAPx79(Lus10014128|PACid:23156862)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuAPx79
start..stop
S start..stop
LuAPx104 574 0 1..285 1..285
LsaAPx02 484 2e-175 1..285 1..285
HaAPx03 478 4e-173 1..285 1..285
CiAPx02 478 5e-173 1..282 1..282
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 522860..522972 113 N° 2 523055..523179 125 N° 3 523303..523352 50 N° 4 523891..523956 66
N° 5 524049..524097 49 N° 6 525099..525181 83 N° 7 525268..525347 80 N° 8 525443..525545 103
N° 9 525931..526119 189  
join(522860..522972,523055..523179,523303..523352,523891..523956,524049..524097, 525099..525181,525268..525347,525443..525545,525931..526119)


exon

Literature and cross-references LuAPx79(Lus10014128|PACid:23156862)
DNA ref. Phytozome 11:   scaffold1247 (522860..526119)
Protein sequence: LuAPx79(Lus10014128|PACid:23156862)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286
PWM (Da):   %s   31320.08 Transmb domain:   %s   o256-278i
PI (pH):   %s   7.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYPVVDAAYVKEVDKARRDLRALISSKNCAPIMLRLAWHDAGTYDKNTKTGGPNGSIRNDEELAHGANSGLKIALDFEEVKAKHPKITYADLFLAGVVAVEVTGGPTIDFLPGRKDSKISPKEGRLPDAKQGSMHLKDVFHRMGLSDKDIVALSGAHTGRAHSNRSGFEGPWTKEPLKFDNTYFVELLKGETEGLLKLSTDNALLDDPAFRPFVELYADEEAFFKDYASAHKKLSELGFSPSSKVTQKDSTVLAQGAVGIVVTAAVMFFSYMYEVHRRSK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTACCCCGTCGTCGATGCCGCTTACGTCAAGGAAGTTGACAAGGCTCGCCGCGATCTCCGTGCTCTCATCTCCTCCAAGAACTGCGCTCCGATCATGCTCCGCTTGGCGTAACCG
TCCTATTGCTGTTTTCGTTTTCTCAATTTGACTTGCTTGTTGGTTTCCTGATCTTCGCCCTTGGTAAATTTTCAGTTGGCACGACGCCGGGACGTATGATAAGAACACCAAGACCGGTGG
ACCTAATGGCTCCATTAGGAACGACGAGGAGCTGGCTCACGGTGCTAACAGTGGCTTGAAGATCGCTCTCGATTTCTGCG
GTGAGATTGATGTCTTTAGTTTGTTTATCACAATTTTAAT
ATGTTTGTTGGGAGCGATATCTGCCCGTTCGTCTTCGAGTGATGATCGATTGCTGAACTGAGTGTTCTTACCTTGCTCTGTAGAGGAAGTGAAGGCCAAGCATCCTAAAATCACTTACGC
CGATTTGTTCCAG
GTGATTGCTTTTGATGAGTTTGCTTGCTTTCTGCTGTAGACGTTCTCTCCCGAGCTGTTTGTTTGAATTGTGAGACTTATAATTCTTTTGCACTGGATATCCTACTG
CTAGATGGTAGTGAAGTGTGAAGGATTTGGTTAGCAGTATTATTTACCCATATGTATTGCATGATTAGAAATCTTAAGAAAAGTTTAGAAACACGACTTTCATCTACATTCCTCTGATAA
ATTAGTCAATGTTTGCTCAATCAGAAGCAAGTTTATAGTTCTATATAAAAGTAGCTGAGGTCCGCTTTTCTTATAGTTAATTCCAAGGCGATTACAAAGGACGCCAATCACGTCTTGTTC
TCTAGCAGTATCTTTGTGCTTCTAGTTTCTTGTTCATTACTTTGACAGAACACAGTGCCCAAGTTTAGATTATCATACTTGTCCAAAAAAAAAGTTTAGATTATCATCTGATGACTGAGA
GTTGACAACTGCTCTTGAATTAGAATTTATTTTTTGTTACCAACTAATTCGGTTTTCATGCATCACTGTAGCTGGCTGGTGTCGTTGCAGTTGAGGTAACTGGAGGTCCAACCATCGACT
TTCTCCCTGGCAGGAAG
GTATGTGAACGTTGGCTAATAGTTATACAACTTCAATGTATTTAGTCGATTACGTTTTTTGAAGTTACTGACTGAGATGTTCTGTATATCAGGATTCAAAAAT
TTCCCCCAAGGAAGGGAGACTTCCGGATGCCAAACAAG
GTATAAGCGATTAAAGATATTAGCTCTTGATTTACACAGTTATCACCAATATTTGTCACTGATCATTAATTCTATGTTACTT
GATCTCCTTGAAATCCCTAGCTTTCCTCTCTCTCTTTGTATGAGGATGGCGGCAGTAGTTTATGATGGTGGAACAAATTTAGAGTTTGTTAACATTCTCAGAAGAAATTTCCTTCATCAT
CACTGATTTAAGTGTTTCCTTTAACATATTGTTGGAAAGCCAATTCATTTGAACTAAGTCCATGGCACGAGTTTTCTTGTTCCTTGAATCAATCTTTCCAAGTGTTGGTGTTTGTAAGAA
TTTTCTTTGAAATATCCTTGAGGATGCAGCCCTAGGTGATGCTTTTGATTTTTCTTGAGGTATCTTTCTGTGATCTTAGTATCTCCTGGGCTCTCAGATTTTTATTTGCATTCCTAGGAC
ATAACTGGCCTCTGATACCCTCCGAGTAACGTTTATGTTCATTGAAGAAAGAGCTATGCATTGGTCTTGTTGTCCTAAATCAGACTACTTGTTTTCGTAACTGACTATCTATTTCCTAAC
CTAGACACCTAGTGGAAGCATGCGCGGCTTGAATTTATGATTCCAAGGCTTAGTAGCTTTCGCCTTATGTAGATTGCCAAGGGTCATCCATGAGAATTCATATAGTGTATTAAGGTGAAG
TGCAACACTGTTTTTTTATGTGATCATTGAAACGTTTCTTGTTGGTCATGGCCTACCTAGTTCTTAGCGTCCCATTTTGCTATCTTCATTGCAGGTTACTTGTTCTCTTACCTAGTTAAT
TCACCTTGTGGATTATCTCACCTTTGCTGCGAATGACTGTCCTTCATTTCATTATTATTCGGTAGAATCAGTAATTCAACTCCTGATAGACCCTTGATATTCTGCCTGTTCTTTTTGCAA
CTATATATATAGGTGAGAATTCTGCATGATTACAAAATTGTTGGATTCATTCTACATATTCTGGTTAATTTTGTGCTAGGTTCAATGCATTTGAAAGACGTATTCCATAGGATGGGTCTG
TCTGATAAGGATATTGTAGCACTGTCAGGAGCCCATACTCTG
GTAATTTCCTACTACTTATCTTTTTTCCTTTACCAATACTAGAATAAACAAACCTTAACTTTCAAGTCTAAATGGTGT
TTCTGCAGGGAAGGGCACATTCAAATAGATCAGGCTTTGAAGGCCCATGGACCAAGGAACCACTGAAGTTTGACAATACATATTTCGTGTAAGCTTCTGAATTCACAGTAGACTAGCATT
GGTCACAGAAATCGTGCAAAAATCACCCGGTTCAAAATCATAATTCCATGTCTGATATTCCAGGGAACTGCTGAAGGGTGAGACTGAGGGACTACTCAAACTCTCAACTGACAACGCCTT
GTTGGATGATCCAGCTTTCCGTCCTTTCGTTGAGCTTTATGCAAAG
GTAGGGCTACAAACATTTCGTTTATCAAGTTTTCTCTCTTCATTTGCTCGATCTTCACATCCAAACTCAGTATT
CTTTATCCTTCATAATACTAGAAATCATTCTGGCTTCCCTAAGCTGTAGAGTATAGATTCGCACTCGGAGATATTTTTGGCCGTGGTTTTGGACTTTTGGTCACAGGTTCCGTTTGTTCT
CCATAGTCCATCCAACTTCTTTTTTCGAGTAAAACTAATACCATAAATACATACAGTAGTCTCTGGAATCTGTACTGTCGTTTTCTTGACACGTAACTAGAAGTATATATCTGAAACCAA
AATAGCATCAAATTCGTGGCTTGGCCAGTATGTTTATATGCATGATGCTTGATTTGGCTTGTTATTGGCAGGATGAGGAAGCATTCTTCAAGGACTACGCTTCCGCGCACAAGAAACTCT
CCGAACTTGGCTTTTCCCCATCCTCGAAAGTAACTCAGAAAGACAGCACCGTACTGGCACAGGGAGCAGTTGGAATAGTGGTAACTGCTGCAGTTATGTTCTTCAGCTACATGTACGAAG
TCCACAGGCGATCCAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTACCCCGTCGTCGATGCCGCTTACGTCAAGGAAGTTGACAAGGCTCGCCGCGATCTCCGTGCTCTCATCTCCTCCAAGAACTGCGCTCCGATCATGCTCCGCTTGGCTTGGCAC
GACGCCGGGACGTATGATAAGAACACCAAGACCGGTGGACCTAATGGCTCCATTAGGAACGACGAGGAGCTGGCTCACGGTGCTAACAGTGGCTTGAAGATCGCTCTCGATTTCTGCG
AG
GAAGTGAAGGCCAAGCATCCTAAAATCACTTACGCCGATTTGTTCCAG
CTGGCTGGTGTCGTTGCAGTTGAGGTAACTGGAGGTCCAACCATCGACTTTCTCCCTGGCAGGAAGGATTCA
AAAATTTCCCCCAAGGAAGGGAGACTTCCGGATGCCAAACAAG
GTTCAATGCATTTGAAAGACGTATTCCATAGGATGGGTCTGTCTGATAAGGATATTGTAGCACTGTCAGGAGCCCAT
ACTCTG
GGAAGGGCACATTCAAATAGATCAGGCTTTGAAGGCCCATGGACCAAGGAACCACTGAAGTTTGACAATACATATTTCGTGGAACTGCTGAAGGGTGAGACTGAGGGACTACTC
AAACTCTCAACTGACAACGCCTTGTTGGATGATCCAGCTTTCCGTCCTTTCGTTGAGCTTTATGCAAAG
GATGAGGAAGCATTCTTCAAGGACTACGCTTCCGCGCACAAGAAACTCTCC
GAACTTGGCTTTTCCCCATCCTCGAAAGTAACTCAGAAAGACAGCACCGTACTGGCACAGGGAGCAGTTGGAATAGTGGTAACTGCTGCAGTTATGTTCTTCAGCTACATGTACGAAGTC
CACAGGCGATCCAAGTAG

Retrieve as FASTA